Sus scrofa (pig): 733606 Help Entry 733606            CDS       T01009                                  Symbol TMSB4X Name (RefSeq) thymosin beta-4   KO K05764   thymosin, beta 4 Organism ssc  Sus scrofa (pig) Pathway ssc04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:ssc00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     733606 (TMSB4X)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ssc04812]     733606 (TMSB4X) Cytoskeleton proteins [BR:ssc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      733606 (TMSB4X) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thymosin WH2 Qua1 Motif Other DBs NCBI-GeneID:  733606 NCBI-ProteinID:  NP_001038020 Ensembl:  ENSSSCG00000012119 Vega:  OTTSUSG00000004352 UniProt:  Q95274 B3XXC3 LinkDB All DBs Position X:9649516..9651662 Genome browser AA seq 44 aa AA seqDB search MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaaacccgatatggctgagattgagaaattcgataagtcgaaattgaagaag acagaaacgcaagagaaaaatccactgccttcaaaagaaacgattgaacaggagaagcaa gcaggcgagtcgtaa

DBGET integrated database retrieval system