Candidatus Sulfuricurvum sp. RIFRC-1: B649_02150 Help Entry B649_02150        CDS       T02537                                  Name (GenBank) hypothetical protein   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism sulr  Candidatus Sulfuricurvum sp. RIFRC-1 Pathway sulr00790   Folate biosynthesis sulr01100   Metabolic pathways sulr01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:sulr00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     B649_02150 Enzymes [BR:sulr01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      B649_02150  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      B649_02150  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      B649_02150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AFV96744 UniProt:  K7SYY6 LinkDB All DBs Position complement(421321..421650) Genome browser AA seq 109 aa AA seqDB search MTILIESLTFETIIGILDHERITPQQVRIDCTIDYPYSAGNFINYADVTQIIEATMKHER FELIETALNLLGTTLKQNFPLIEELTLSIRKPDILSNCTVGVQHTIRYI NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgacaatcctcatcgagagtctaacctttgaaaccatcatcggtattctcgaccacgaa cgcattactcctcagcaggtgcgtatcgattgtacaatcgactatccctactctgcgggt aacttcattaattacgccgacgtaactcagatcatcgaagcgacgatgaaacatgaacga tttgagttaatcgaaactgctttaaaccttttgggtacgactctgaaacaaaactttcca ctaattgaagaacttactttaagcattcgcaagcctgatattttgtccaattgtaccgtc ggcgttcagcatacaatccgctatatataa

DBGET integrated database retrieval system