Tachysurus fulvidraco (yellow catfish): 113662974 Help Entry 113662974         CDS       T08119                                  Name (RefSeq) permeability factor 2-like   KO K10030   interleukin 8 Organism tfd  Tachysurus fulvidraco (yellow catfish) Pathway tfd04060   Cytokine-cytokine receptor interaction tfd04218   Cellular senescence tfd04620   Toll-like receptor signaling pathway tfd04621   NOD-like receptor signaling pathway tfd04622   RIG-I-like receptor signaling pathway tfd05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tfd00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     113662974  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     113662974  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     113662974    04621 NOD-like receptor signaling pathway     113662974    04622 RIG-I-like receptor signaling pathway     113662974  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113662974  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tfd04052]     113662974    00536 Glycosaminoglycan binding proteins [BR:tfd00536]     113662974 Cytokines and neuropeptides [BR:tfd04052]  Cytokines   Chemokines    113662974 Glycosaminoglycan binding proteins [BR:tfd00536]  Heparan sulfate / Heparin   Chemokines    113662974 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 DUF4732 Motif Other DBs NCBI-GeneID:  113662974 NCBI-ProteinID:  XP_027033970 LinkDB All DBs Position 1:39522608..39524401 Genome browser AA seq 93 aa AA seqDB search MNHSALVITFLTCALLAMTEGVPRLQPRCLCTETMQREISDQRIVKIEIHQPGPHCINTE VIATVKFHKEITLCLNPTDHWVQRALKKRNLTP NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccactcagctcttgtcatcacttttctaacctgtgctctcttggcaatgacggaa ggagttccacgcctgcagcctagatgcctgtgtacagaaacaatgcaacgggaaatctct gatcaaagaattgtgaaaattgagatccatcaacctggtcctcattgcataaatacagaa gtaatcgctacggtgaaattccacaaagaaattacattgtgcctcaatcctacagaccac tgggttcaaagagccctcaaaaaaagaaacctgacaccttag

DBGET integrated database retrieval system