Tuber melanosporum: GSTUM_00000005001 Help Entry GSTUM_00000005001 CDS       T01282                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism tml  Tuber melanosporum Pathway tml03060   Protein export tml04141   Protein processing in endoplasmic reticulum tml04145   Phagosome Brite KEGG Orthology (KO) [BR:tml00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     GSTUM_00000005001    04141 Protein processing in endoplasmic reticulum     GSTUM_00000005001  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     GSTUM_00000005001  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tml04131]     GSTUM_00000005001   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tml02044]     GSTUM_00000005001 Membrane trafficking [BR:tml04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     GSTUM_00000005001 Secretion system [BR:tml02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    GSTUM_00000005001 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE HRG Motif Other DBs NCBI-GeneID:  9188400 NCBI-ProteinID:  XP_002835306 INRA:  GSTUM_00000005001 UniProt:  D5G4M0 LinkDB All DBs AA seq 70 aa AA seqDB search MSDQFAQIADIPREFLKDGTLFINRCTKPDKREFIKISQAVGIGFVIMGVIGFIVKLIHI PVNNILVGAA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtctgaccaatttgctcaaatagctgacattcctcgcgagttcctaaaggatggaact cttttcatcaatcgttgcaccaagccggacaagagagaatttatcaagatttctcaagct gtcggtattggtttcgtcattatgggggtaatcgggtttatcgtaaagctcatccacatc ccagtcaacaatattttagttggcgctgcgtaa

DBGET integrated database retrieval system