Thermotoga maritima Tma200: THMC_0012 Help Entry THMC_0012         CDS       T03901                                  Name (GenBank) pyruvate synthase   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism tmx  Thermotoga maritima Tma200 Pathway tmx00010   Glycolysis / Gluconeogenesis tmx00020   Citrate cycle (TCA cycle) tmx00620   Pyruvate metabolism tmx00633   Nitrotoluene degradation tmx00640   Propanoate metabolism tmx00650   Butanoate metabolism tmx00680   Methane metabolism tmx01100   Metabolic pathways tmx01110   Biosynthesis of secondary metabolites tmx01120   Microbial metabolism in diverse environments tmx01200   Carbon metabolism tmx01210   2-Oxocarboxylic acid metabolism Module tmx_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:tmx00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     THMC_0012    00020 Citrate cycle (TCA cycle)     THMC_0012    00620 Pyruvate metabolism     THMC_0012    00640 Propanoate metabolism     THMC_0012    00650 Butanoate metabolism     THMC_0012   09102 Energy metabolism    00680 Methane metabolism     THMC_0012   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     THMC_0012 Enzymes [BR:tmx01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      THMC_0012 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_6 Fer4_9 Fer4_7 Fer4_16 Fer4_10 Fer4_2 Fer4_4 Fer4_13 Fer4_3 Fer4_18 Fer4_17 Fer4_15 Fer4_22 Motif Other DBs NCBI-ProteinID:  AKE25963 LinkDB All DBs Position 13836..14135 Genome browser AA seq 99 aa AA seqDB search MSLKSWKEIPIGGVIDKPGTAREYKTGAWRVMRPILHKEKCIDCMFCWLYCPDQAIIQEG GIMKGFNYDYCKGCGLCANVCPKQAIEMRPETEFLSEEG NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtctcttaaaagctggaaggaaattcccattggaggagtcatcgacaaaccgggaaca gcaagagaatacaaaacaggtgcctggcgtgtgatgagacctattcttcacaaagagaaa tgtatagactgtatgttctgctggctctactgtccagatcaagcgatcatccaagaaggc ggaataatgaaaggtttcaactacgactactgtaaaggatgcggactctgtgcgaacgta tgtccaaagcaggccatagagatgagacctgagactgagtttctgagcgaggagggatga

DBGET integrated database retrieval system