Talpa occidentalis (Iberian mole): 119243508 Help Entry 119243508         CDS       T07495                                  Name (RefSeq) cytochrome c   KO K08738   cytochrome c Organism tod  Talpa occidentalis (Iberian mole) Pathway tod00190   Oxidative phosphorylation tod01100   Metabolic pathways tod01524   Platinum drug resistance tod04115   p53 signaling pathway tod04210   Apoptosis tod04215   Apoptosis - multiple species tod04932   Non-alcoholic fatty liver disease tod05010   Alzheimer disease tod05012   Parkinson disease tod05014   Amyotrophic lateral sclerosis tod05016   Huntington disease tod05017   Spinocerebellar ataxia tod05020   Prion disease tod05022   Pathways of neurodegeneration - multiple diseases tod05132   Salmonella infection tod05134   Legionellosis tod05145   Toxoplasmosis tod05152   Tuberculosis tod05160   Hepatitis C tod05161   Hepatitis B tod05162   Measles tod05163   Human cytomegalovirus infection tod05164   Influenza A tod05167   Kaposi sarcoma-associated herpesvirus infection tod05168   Herpes simplex virus 1 infection tod05169   Epstein-Barr virus infection tod05170   Human immunodeficiency virus 1 infection tod05200   Pathways in cancer tod05210   Colorectal cancer tod05222   Small cell lung cancer tod05416   Viral myocarditis tod05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tod00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     119243508  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     119243508    04215 Apoptosis - multiple species     119243508    04115 p53 signaling pathway     119243508  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119243508   09162 Cancer: specific types    05210 Colorectal cancer     119243508    05222 Small cell lung cancer     119243508   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     119243508    05161 Hepatitis B     119243508    05160 Hepatitis C     119243508    05164 Influenza A     119243508    05162 Measles     119243508    05168 Herpes simplex virus 1 infection     119243508    05163 Human cytomegalovirus infection     119243508    05167 Kaposi sarcoma-associated herpesvirus infection     119243508    05169 Epstein-Barr virus infection     119243508   09171 Infectious disease: bacterial    05132 Salmonella infection     119243508    05134 Legionellosis     119243508    05152 Tuberculosis     119243508   09174 Infectious disease: parasitic    05145 Toxoplasmosis     119243508   09164 Neurodegenerative disease    05010 Alzheimer disease     119243508    05012 Parkinson disease     119243508    05014 Amyotrophic lateral sclerosis     119243508    05016 Huntington disease     119243508    05017 Spinocerebellar ataxia     119243508    05020 Prion disease     119243508    05022 Pathways of neurodegeneration - multiple diseases     119243508   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     119243508    05416 Viral myocarditis     119243508   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     119243508   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     119243508 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  119243508 NCBI-ProteinID:  XP_037365313 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MSDIEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW KEDTLMEYLENPKKYIPGTKMIFAGIKKKSERAELIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgagtgacattgagaagggcaagaagatttttgttcaaaagtgtgcccagtgccatact gtggaaaagggaggcaagcacaaaactgggccaaatctccatggtctctttgggcgaaag acaggtcaggcccctggattttcttacacagatgccaacaagaacaaaggcatcacctgg aaagaggacacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa atgatcttcgctggcattaagaagaagtcagaaagggcagagttgatagcttatctcaag aaagctactaatgagtaa

DBGET integrated database retrieval system