Talpa occidentalis (Iberian mole): 119257243 Help Entry 119257243         CDS       T07495                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04146   Peroxisome tod04213   Longevity regulating pathway - multiple species tod05012   Parkinson disease tod05014   Amyotrophic lateral sclerosis tod05016   Huntington disease tod05020   Prion disease tod05022   Pathways of neurodegeneration - multiple diseases tod05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:tod00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     119257243 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     119257243 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     119257243 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     119257243 (SOD1)    05014 Amyotrophic lateral sclerosis     119257243 (SOD1)    05016 Huntington disease     119257243 (SOD1)    05020 Prion disease     119257243 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     119257243 (SOD1) Enzymes [BR:tod01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      119257243 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  119257243 NCBI-ProteinID:  XP_037380936 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search MATKAVCVLKGDGPVKGTIHFEQKANMVEVSGSITGLTEGEHGFHVHQFGDNTQGCTSAG PHFNPHSKKHGGPKDSERHVGDLGNVTAGKDGKATVFIQDSMISLSGEHSIIGRTMVVHE KQDDLGKGGNEESTKTGNAGSRLACGVIGITQ NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggcgaccaaggccgtgtgcgtgttgaagggcgacggcccggtcaagggcaccatccac ttcgagcagaaggcgaacatggtggaggtgtcgggatccattacaggactgaccgagggc gagcacggattccacgtccatcagtttggagataacacgcaaggctgtaccagtgcaggt cctcactttaatcctcattccaaaaagcacggtgggccaaaggattcagagaggcatgtt ggagacctgggcaatgtgactgctggcaaagacggcaaggccacggtgtttatccaggat tctatgatctctctctcaggagagcattccatcattggccgcacgatggtggtccatgaa aaacaagatgacttgggcaaaggtggcaacgaagaaagtacaaagacaggaaatgctgga agtcgtttggcttgcggtgtcattggcatcacccaataa

DBGET integrated database retrieval system