Talpa occidentalis (Iberian mole): 119259188 Help Entry 119259188         CDS       T07495                                  Symbol IL1B Name (RefSeq) interleukin-1 beta isoform X1   KO K04519   interleukin 1 beta Organism tod  Talpa occidentalis (Iberian mole) Pathway tod01523   Antifolate resistance tod04010   MAPK signaling pathway tod04060   Cytokine-cytokine receptor interaction tod04064   NF-kappa B signaling pathway tod04217   Necroptosis tod04380   Osteoclast differentiation tod04620   Toll-like receptor signaling pathway tod04621   NOD-like receptor signaling pathway tod04623   Cytosolic DNA-sensing pathway tod04625   C-type lectin receptor signaling pathway tod04640   Hematopoietic cell lineage tod04657   IL-17 signaling pathway tod04659   Th17 cell differentiation tod04668   TNF signaling pathway tod04750   Inflammatory mediator regulation of TRP channels tod04932   Non-alcoholic fatty liver disease tod04933   AGE-RAGE signaling pathway in diabetic complications tod04936   Alcoholic liver disease tod04940   Type I diabetes mellitus tod05010   Alzheimer disease tod05020   Prion disease tod05022   Pathways of neurodegeneration - multiple diseases tod05132   Salmonella infection tod05133   Pertussis tod05134   Legionellosis tod05135   Yersinia infection tod05140   Leishmaniasis tod05142   Chagas disease tod05143   African trypanosomiasis tod05144   Malaria tod05146   Amoebiasis tod05152   Tuberculosis tod05162   Measles tod05163   Human cytomegalovirus infection tod05164   Influenza A tod05168   Herpes simplex virus 1 infection tod05171   Coronavirus disease - COVID-19 tod05321   Inflammatory bowel disease tod05323   Rheumatoid arthritis tod05332   Graft-versus-host disease tod05417   Lipid and atherosclerosis tod05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     119259188 (IL1B)    04064 NF-kappa B signaling pathway     119259188 (IL1B)    04668 TNF signaling pathway     119259188 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     119259188 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     119259188 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     119259188 (IL1B)    04620 Toll-like receptor signaling pathway     119259188 (IL1B)    04621 NOD-like receptor signaling pathway     119259188 (IL1B)    04623 Cytosolic DNA-sensing pathway     119259188 (IL1B)    04625 C-type lectin receptor signaling pathway     119259188 (IL1B)    04659 Th17 cell differentiation     119259188 (IL1B)    04657 IL-17 signaling pathway     119259188 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     119259188 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     119259188 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     119259188 (IL1B)    05164 Influenza A     119259188 (IL1B)    05162 Measles     119259188 (IL1B)    05168 Herpes simplex virus 1 infection     119259188 (IL1B)    05163 Human cytomegalovirus infection     119259188 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     119259188 (IL1B)    05135 Yersinia infection     119259188 (IL1B)    05133 Pertussis     119259188 (IL1B)    05134 Legionellosis     119259188 (IL1B)    05152 Tuberculosis     119259188 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     119259188 (IL1B)    05144 Malaria     119259188 (IL1B)    05140 Leishmaniasis     119259188 (IL1B)    05142 Chagas disease     119259188 (IL1B)    05143 African trypanosomiasis     119259188 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     119259188 (IL1B)    05321 Inflammatory bowel disease     119259188 (IL1B)    05332 Graft-versus-host disease     119259188 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     119259188 (IL1B)    05020 Prion disease     119259188 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     119259188 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     119259188 (IL1B)    05418 Fluid shear stress and atherosclerosis     119259188 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     119259188 (IL1B)    04936 Alcoholic liver disease     119259188 (IL1B)    04932 Non-alcoholic fatty liver disease     119259188 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     119259188 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     119259188 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tod04052]     119259188 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:tod00536]     119259188 (IL1B) Cytokines and neuropeptides [BR:tod04052]  Cytokines   Interleukins    119259188 (IL1B) Glycosaminoglycan binding proteins [BR:tod00536]  Heparan sulfate / Heparin   Cytokines    119259188 (IL1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  119259188 NCBI-ProteinID:  XP_037383709 LinkDB All DBs Position Unknown AA seq 268 aa AA seqDB search MAAAPELSNEMAYHSSSENDRYFEANGPKQMKQCFQDLDLISQEDDGIEFQISSQLYNKK FRRVVSIIVTVEKLRNMLVPDSLTFRNDNLRSLFLFIFEEEPILCDEDDDDLLCDAPPRW LNCRLQDIEQKSLVLSDACQLHALHLRGESLDQQVVFCMSFVQGEETNNKIPVALGLKDK NLYLSCVMKDGKPTLQLETVDPKMYPKKKMEERFVFNKTAIKEHFEFESAQFPNWYISTS QAEQMPLFLGNTRGNQDITDFSMEVISP NT seq 807 nt NT seq  +upstreamnt  +downstreamnt atggcagcagctcctgaactttccaatgaaatggcttaccacagcagcagtgagaatgac cggtacttcgaggccaatggccccaaacagatgaagcaatgcttccaagacctggacctc atttctcaggaagatgatggcatcgagttccaaatctccagccagctctacaacaagaag ttcaggcgggtggtgtcgatcattgtgactgtggagaagctgcggaacatgctcgttcct gactcgctgacattccggaatgacaacctcaggagcctctttttgttcatctttgaagaa gaacccatcctttgtgacgaggatgatgacgatttgttgtgtgatgcacctccaagatgg ctgaactgcaggctccaggacatagaacaaaagagcctggtgctgtctgatgcatgtcag cttcacgctctccacctcagaggagagtctctggatcaacaagtggtgttctgcatgagc tttgtgcaaggagaagaaaccaacaacaagatacccgtggccttgggcctcaaggataag aatctgtacctgtcgtgtgtgatgaaagatggaaagcccaccctgcagctggagacggta gaccccaaaatgtacccaaagaagaagatggaagagagatttgtcttcaataagacagca atcaaggagcattttgaatttgagtctgcccagttccccaactggtacatcagcacctct caagcagaacaaatgcccctcttcctgggaaacaccagaggcaaccaggatataactgac ttctccatggaagtcatctctccttaa

DBGET integrated database retrieval system