Thrips palmi (melon thrips): 117645320 Help Entry 117645320         CDS       T08251                                  Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism tpal  Thrips palmi (melon thrips) Pathway tpal03008   Ribosome biogenesis in eukaryotes tpal03013   Nucleocytoplasmic transport tpal03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:tpal00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     117645320    03008 Ribosome biogenesis in eukaryotes     117645320   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     117645320  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tpal03019]     117645320    03009 Ribosome biogenesis [BR:tpal03009]     117645320    03016 Transfer RNA biogenesis [BR:tpal03016]     117645320    03036 Chromosome and associated proteins [BR:tpal03036]     117645320   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tpal04147]     117645320    04031 GTP-binding proteins [BR:tpal04031]     117645320 Messenger RNA biogenesis [BR:tpal03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      117645320 Ribosome biogenesis [BR:tpal03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     117645320   Pre-60S particles     117645320 Transfer RNA biogenesis [BR:tpal03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     117645320 Chromosome and associated proteins [BR:tpal03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      117645320    Spindle formation proteins     117645320 Exosome [BR:tpal04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    117645320 GTP-binding proteins [BR:tpal04031]  Small (monomeric) G-proteins   Ran Family    Ran     117645320 BRITE hierarchy Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RNA_helicase ArgoMid Gtr1_RagA AAA_24 AAA_16 AAA_7 Pox_A32 DUF5906 AAA_33 AAA_22 Motif Other DBs NCBI-GeneID:  117645320 NCBI-ProteinID:  XP_034241299 UniProt:  A0A6P8YVU0 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MAAESDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKRYVATLGVEVHPLVFHTNRGPIRF NVWDTAGQEKFGGLRDGYYIQGQCAIVMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCG NKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPA LVPPEVTMDPQWQHQIEKDLKEAQETALPEDEEEL NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggcggccgaatctgatatgcccaccttcaagtgcgtcctggttggagacggaggcaca ggaaaaactacattcgtcaagcgccatctcacaggagagttcgagaagagatacgttgcc acccttggcgtagaggttcaccctctggtgttccacacaaacagaggacctatccgtttc aacgtttgggatactgctggccaagagaagttcggtgggctcagagacggatactacatt cagggacaatgtgccattgttatgtttgatgtcacatcacgagtaacatacaagaatgtt cccaactggcacagagatcttgtccgagtttgtgaaaacatcccaatcgttctatgtggt aataaggttgatatcaaggacaggaaggtgaaagccaagagcatagtattccacaggaag aagaaccttcagtactacgacattagtgcgaaaagtaactacaacttcgaaaagcctttc ctgtggctcgcccgcaagctgattggagaccccaacctcgagtttgttgctatgcctgcc ctcgttcccccagaagttaccatggatccccaatggcagcaccagatcgaaaaggatctc aaggaagctcaagaaactgcactgccagaggatgaagaagagctgtga

DBGET integrated database retrieval system