Trifolium pratense (red clover): 123909571 Help Entry 123909571         CDS       T08949                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism tpra  Trifolium pratense (red clover) Pathway tpra03083   Polycomb repressive complex tpra04120   Ubiquitin mediated proteolysis tpra04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:tpra00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     123909571    04120 Ubiquitin mediated proteolysis     123909571   09126 Chromosome    03083 Polycomb repressive complex     123909571  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tpra04131]     123909571    04121 Ubiquitin system [BR:tpra04121]     123909571    03036 Chromosome and associated proteins [BR:tpra03036]     123909571 Membrane trafficking [BR:tpra04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     123909571 Ubiquitin system [BR:tpra04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    SCF complex     Adaptor protein      123909571    Cul7 complex      123909571 Chromosome and associated proteins [BR:tpra03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      123909571   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      123909571 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  123909571 NCBI-ProteinID:  XP_045816386 LinkDB All DBs Position LG2:13347746..13349604 Genome browser AA seq 155 aa AA seqDB search MSSGKKITLKSSDGEAFEIDEIVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYC KKHVESVGSDEKPNDEELKAWDADFVKVDQATLFDLILAANYLNIKNLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFSPEEEEEVRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcttctggcaagaaaatcactttgaagagttccgatggagaggcttttgagatcgac gaaattgttgctttggaatcgcagacgattaagcatatgattgaagacgattgcgctgat aatggaattcctcttccaaacgtcaccagcaagatccttgcaaaggtgatcgagtactgc aaaaagcatgtggagtctgtgggttctgatgagaaacctaacgacgaggaacttaaggct tgggatgcggatttcgttaaggtggatcaggctacgcttttcgatctaatcttggctgct aactacttgaacattaagaacctgttggaccttacctgccaaactgtggctgacatgatc aaggggaagaccccagaggagatcaggaagaccttcaacatcaagaatgacttctctcct gaggaagaagaggaagtccgtagggaaaaccagtgggcttttgaatga

DBGET integrated database retrieval system