Tupaia chinensis (Chinese tree shrew): 102500056 Help Entry 102500056         CDS       T02978                                  Symbol SOD1 Name (RefSeq) superoxide dismutase 1   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04146   Peroxisome tup04213   Longevity regulating pathway - multiple species tup05012   Parkinson disease tup05014   Amyotrophic lateral sclerosis tup05016   Huntington disease tup05020   Prion disease tup05022   Pathways of neurodegeneration - multiple diseases tup05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:tup00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     102500056 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     102500056 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     102500056 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     102500056 (SOD1)    05014 Amyotrophic lateral sclerosis     102500056 (SOD1)    05016 Huntington disease     102500056 (SOD1)    05020 Prion disease     102500056 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     102500056 (SOD1) Enzymes [BR:tup01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      102500056 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  102500056 NCBI-ProteinID:  XP_006155323 LinkDB All DBs Position Un AA seq 153 aa AA seqDB search MALKAVCVLKGDGPVQGTIHFEQKENGPVLVTGRIMGLTEGQHGFHVHQFGDNTQGCTSA GPHFNPESKKHGGPSDQERHVGDLGNVIAGKDGVADVSIEDVVISLSGAHSIIGRTMVVH EKADDLGRGGNEESTKTGNAGSRLACGVIGIAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcgttgaaggcggtgtgcgtgctgaagggcgatggcccagtgcagggcaccatccac ttcgagcagaaggagaatggtccagttttggtaactggacgcatcatgggattgactgaa ggccagcatggattccatgtccatcagttcggagataatacacaaggttgtaccagtgct ggtcctcactttaatcctgaatccaaaaaacatggtgggccaagtgatcaagagaggcat gttggagacctgggcaatgtgattgcaggcaaagatggtgtggcagatgtgtctattgaa gatgttgtgatctcactttcaggagctcattccatcattggccgcacaatggtggtccat gaaaaagcagatgacttgggcagaggtggaaatgaagaaagtacaaagacaggaaatgct ggaagtcgtttggcgtgtggtgtaattgggatcgcccaataa

DBGET integrated database retrieval system