Ursus americanus (American black bear): 123784194 Help Entry 123784194         CDS       T07931                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism uar  Ursus americanus (American black bear) Pathway uar04146   Peroxisome uar04213   Longevity regulating pathway - multiple species uar05012   Parkinson disease uar05014   Amyotrophic lateral sclerosis uar05016   Huntington disease uar05020   Prion disease uar05022   Pathways of neurodegeneration - multiple diseases uar05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:uar00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     123784194 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     123784194 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     123784194 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     123784194 (SOD1)    05014 Amyotrophic lateral sclerosis     123784194 (SOD1)    05016 Huntington disease     123784194 (SOD1)    05020 Prion disease     123784194 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     123784194 (SOD1) Enzymes [BR:uar01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      123784194 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  123784194 NCBI-ProteinID:  XP_045641461 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MEMKAVCVLKGQGPVEGTIHFVQKGGGPVVVSGTITGLTEGEHGFHVHQFGDNTQGCTSA GPHFNPLSKKHGGPKDEERHVGDLGNVIAGKDGVATVSLEDSLIALSGDHSIIGRTMVVH EKRDDLGKGGNEESTQTGNAGSRLACGVIGIAK NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggagatgaaggctgtgtgcgtgctgaagggccagggcccggtggaaggcaccatccac ttcgtgcagaagggaggtgggcctgttgtggtgtcaggaaccattacaggattgactgaa ggcgagcatggattccacgtccatcaatttggagataatacacaaggctgtaccagtgca ggtcctcactttaatcctctatccaaaaaacacggtgggccaaaagatgaagagaggcat gttggagacctgggcaatgtgattgctggcaaggatggcgtggccaccgtgtccttggaa gattctctgatcgcactctcaggagaccattccatcattggccgcacaatggtggtccac gagaaacgagatgacttgggcaaaggtggcaacgaagaaagtacacagacgggaaacgcc gggagtcgtttggcttgtggtgtcattgggatcgccaagtaa

DBGET integrated database retrieval system