Ursus maritimus (polar bear): 103670861 Help Entry 103670861         CDS       T03271                                  Symbol JUN Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism umr  Ursus maritimus (polar bear) Pathway umr01522   Endocrine resistance umr04010   MAPK signaling pathway umr04012   ErbB signaling pathway umr04024   cAMP signaling pathway umr04137   Mitophagy - animal umr04210   Apoptosis umr04310   Wnt signaling pathway umr04380   Osteoclast differentiation umr04510   Focal adhesion umr04530   Tight junction umr04620   Toll-like receptor signaling pathway umr04621   NOD-like receptor signaling pathway umr04625   C-type lectin receptor signaling pathway umr04657   IL-17 signaling pathway umr04658   Th1 and Th2 cell differentiation umr04659   Th17 cell differentiation umr04660   T cell receptor signaling pathway umr04662   B cell receptor signaling pathway umr04668   TNF signaling pathway umr04722   Neurotrophin signaling pathway umr04912   GnRH signaling pathway umr04915   Estrogen signaling pathway umr04921   Oxytocin signaling pathway umr04926   Relaxin signaling pathway umr04932   Non-alcoholic fatty liver disease umr04933   AGE-RAGE signaling pathway in diabetic complications umr05030   Cocaine addiction umr05031   Amphetamine addiction umr05132   Salmonella infection umr05133   Pertussis umr05135   Yersinia infection umr05140   Leishmaniasis umr05142   Chagas disease umr05161   Hepatitis B umr05162   Measles umr05166   Human T-cell leukemia virus 1 infection umr05167   Kaposi sarcoma-associated herpesvirus infection umr05169   Epstein-Barr virus infection umr05170   Human immunodeficiency virus 1 infection umr05171   Coronavirus disease - COVID-19 umr05200   Pathways in cancer umr05203   Viral carcinogenesis umr05207   Chemical carcinogenesis - receptor activation umr05208   Chemical carcinogenesis - reactive oxygen species umr05210   Colorectal cancer umr05211   Renal cell carcinoma umr05224   Breast cancer umr05231   Choline metabolism in cancer umr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer umr05321   Inflammatory bowel disease umr05323   Rheumatoid arthritis umr05417   Lipid and atherosclerosis umr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103670861 (JUN)    04012 ErbB signaling pathway     103670861 (JUN)    04310 Wnt signaling pathway     103670861 (JUN)    04668 TNF signaling pathway     103670861 (JUN)    04024 cAMP signaling pathway     103670861 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     103670861 (JUN)   09143 Cell growth and death    04210 Apoptosis     103670861 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103670861 (JUN)    04530 Tight junction     103670861 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103670861 (JUN)    04621 NOD-like receptor signaling pathway     103670861 (JUN)    04625 C-type lectin receptor signaling pathway     103670861 (JUN)    04660 T cell receptor signaling pathway     103670861 (JUN)    04658 Th1 and Th2 cell differentiation     103670861 (JUN)    04659 Th17 cell differentiation     103670861 (JUN)    04657 IL-17 signaling pathway     103670861 (JUN)    04662 B cell receptor signaling pathway     103670861 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     103670861 (JUN)    04915 Estrogen signaling pathway     103670861 (JUN)    04921 Oxytocin signaling pathway     103670861 (JUN)    04926 Relaxin signaling pathway     103670861 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     103670861 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     103670861 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103670861 (JUN)    05207 Chemical carcinogenesis - receptor activation     103670861 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     103670861 (JUN)    05203 Viral carcinogenesis     103670861 (JUN)    05231 Choline metabolism in cancer     103670861 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103670861 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     103670861 (JUN)    05211 Renal cell carcinoma     103670861 (JUN)    05224 Breast cancer     103670861 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103670861 (JUN)    05170 Human immunodeficiency virus 1 infection     103670861 (JUN)    05161 Hepatitis B     103670861 (JUN)    05171 Coronavirus disease - COVID-19     103670861 (JUN)    05162 Measles     103670861 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     103670861 (JUN)    05169 Epstein-Barr virus infection     103670861 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     103670861 (JUN)    05135 Yersinia infection     103670861 (JUN)    05133 Pertussis     103670861 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     103670861 (JUN)    05142 Chagas disease     103670861 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     103670861 (JUN)    05321 Inflammatory bowel disease     103670861 (JUN)   09165 Substance dependence    05030 Cocaine addiction     103670861 (JUN)    05031 Amphetamine addiction     103670861 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103670861 (JUN)    05418 Fluid shear stress and atherosclerosis     103670861 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     103670861 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     103670861 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     103670861 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:umr03000]     103670861 (JUN) Transcription factors [BR:umr03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     103670861 (JUN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha FlaC_arch DUF3450 TFIIA NYD-SP28_assoc Motif Other DBs NCBI-GeneID:  103670861 NCBI-ProteinID:  XP_040483176 UniProt:  A0A8M1FIH3 LinkDB All DBs Position Unknown AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASAAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tccgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg aacctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactcggacctc ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata atccagtccagcaacgggcacatcaccactacgccgacccccacgcagttcctgtgcccc aagaacgtgacagacgagcaggagggcttcgccgagggtttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtctgcggcgcagccggtcagcggggcg ggcatggtggctccggcggtggcttcggcggcgggcggcagcggcagcggcggcttcagc gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaaccccggcgcg ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcag ccccagcagcagcagcagcccccgcagccgccgcaccacctgccccagcagatccccgtg cagcacccgcggcttcaggccttgaaggaggagccgcagacggtgcccgagatgcccggg gaaacgccgcccctgtcccccatcgacatggagtcgcaggagaggatcaaggcggagagg aagcgcatgaggaaccgcatagctgcctccaagtgccggaaaaggaagctggagaggatc gccaggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacg gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system