Ursus maritimus (polar bear): 103673102 Help Entry 103673102         CDS       T03271                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism umr  Ursus maritimus (polar bear) Pathway umr04146   Peroxisome umr04213   Longevity regulating pathway - multiple species umr05012   Parkinson disease umr05014   Amyotrophic lateral sclerosis umr05016   Huntington disease umr05020   Prion disease umr05022   Pathways of neurodegeneration - multiple diseases umr05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:umr00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     103673102 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     103673102 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     103673102 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     103673102 (SOD1)    05014 Amyotrophic lateral sclerosis     103673102 (SOD1)    05016 Huntington disease     103673102 (SOD1)    05020 Prion disease     103673102 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     103673102 (SOD1) Enzymes [BR:umr01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      103673102 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  103673102 NCBI-ProteinID:  XP_040476974 UniProt:  A0A8M1F842 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MEMKAVCVLKGQGPVEGTIHFVQKGGGPVVVSGTITGLTEGEHGFHVHQFGDNTQGCTSA GPHFNPLSKKHGGPEDEERHVGDLGNVIAGKDGVATVSLEDSLIALSGDHSIIGRTMVVH EKRDDLGKGGNEESTQTGNAGSRLACGVIGIAK NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggagatgaaggctgtgtgcgtgctgaagggccagggcccggtggaaggcaccatccac ttcgtgcagaagggaggtgggcctgttgtggtgtcaggaaccattacaggattgactgaa ggcgagcatggattccacgtccatcaatttggagataatacacaaggctgtaccagtgca ggtcctcactttaatcctctatccaaaaaacacggtgggccagaagatgaagagaggcat gttggagacctgggcaatgtgattgctggcaaggatggcgtggccaccgtgtccttggaa gattctctgatcgcactctcaggagaccattccatcattggccgcacaatggtggtccac gagaaacgagatgacttgggcaaaggtggcaacgaagaaagtacacagacgggaaacgcc gggagtcgtttggcttgtggtgtcattgggatcgccaagtaa

DBGET integrated database retrieval system