Ursus maritimus (polar bear): 103679511 Help Entry 103679511         CDS       T03271                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism umr  Ursus maritimus (polar bear) Pathway umr03030   DNA replication umr03410   Base excision repair umr03420   Nucleotide excision repair umr03430   Mismatch repair umr03440   Homologous recombination Brite KEGG Orthology (KO) [BR:umr00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     103679511 (POLD4)    03410 Base excision repair     103679511 (POLD4)    03420 Nucleotide excision repair     103679511 (POLD4)    03430 Mismatch repair     103679511 (POLD4)    03440 Homologous recombination     103679511 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:umr03032]     103679511 (POLD4)    03400 DNA repair and recombination proteins [BR:umr03400]     103679511 (POLD4) DNA replication proteins [BR:umr03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     103679511 (POLD4) DNA repair and recombination proteins [BR:umr03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       103679511 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      103679511 (POLD4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_pol_delta_4 DUF3303 Motif Other DBs NCBI-GeneID:  103679511 NCBI-ProteinID:  XP_008707296 UniProt:  A0A384DJW9 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPLSVDEAELELLRQFDLAWQYGP CTGITRLQRWHRAEQMGLEPPPEVRQVLQTHPGDPRFQCSLWHLYPL NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgggccggaagcggctcatcactgactcctaccccgtagtgaagaggagggagggcccc gctgggcacagcaagggggagctggcaccagagctaggggaagagccccagcccctgagc gtggatgaagcagagctggagctgctgaggcagtttgatctcgcctggcagtacgggccc tgcacagggatcacacggctgcagcgctggcatcgggcggagcagatgggcttggagcct cccccagaagtgcgtcaggtgctacagacccaccctggagatccccgcttccagtgcagc ctctggcatctctatcccctttga

DBGET integrated database retrieval system