Vigna angularis (adzuki bean): 108319225 Help Entry 108319225         CDS       T04660                                  Name (RefSeq) ras-related protein Rab11E-like   KO K07904   Ras-related protein Rab-11A Organism var  Vigna angularis (adzuki bean) Pathway var04144   Endocytosis Brite KEGG Orthology (KO) [BR:var00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108319225  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:var04131]     108319225   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:var04147]     108319225    04031 GTP-binding proteins [BR:var04031]     108319225 Membrane trafficking [BR:var04131]  Protein recycling   Rab GTPases and associated proteins    Rab GTPases     108319225 Exosome [BR:var04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    108319225   Exosomal proteins of colorectal cancer cells    108319225 GTP-binding proteins [BR:var04031]  Small (monomeric) G-proteins   Rab Family    Rab11/25 [OT]     108319225 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc MMR_HSR1 RsgA_GTPase Motif Other DBs NCBI-GeneID:  108319225 NCBI-ProteinID:  XP_017405763 LinkDB All DBs Position Un Genome browser AA seq 125 aa AA seqDB search MLLRLPRGPLLSSLASASSLLPTSSSPCYRLSLRLTRSASAFVVTPLLWSPLLWLWQPRV LIHDYLFKLVPIGDSGVGKSNLFSRFTRNEFNLESKSTIRVEFTTKSLNIDSEVIKAQIW DTTGQ NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgttgcttcgtcttcctcgcgggccattgttgtcgtctcttgcctctgcctcgtcgctg ttgccaacatcttcgtcgccgtgttatcgcctcagcctccgcctcactcgtagcgcctct gcctttgtcgtcacgcctctgttgtggtcgcctctgttgtggttgtggcaaccacgggtt ctaatccatgattaccttttcaagctggttccgatcggcgattccggcgtggggaagtcc aaccttttctcgcgcttcacgcggaatgagttcaatttggagtccaagtctaccataaga gttgagttcaccaccaagagtttgaatatcgattccgaggtcatcaaggctcagatttgg gacaccactggccagtaa

DBGET integrated database retrieval system