Vicugna pacos (alpaca): 102545422 Help Entry 102545422         CDS       T08098                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism vpc  Vicugna pacos (alpaca) Pathway vpc04146   Peroxisome vpc04213   Longevity regulating pathway - multiple species vpc05012   Parkinson disease vpc05014   Amyotrophic lateral sclerosis vpc05016   Huntington disease vpc05020   Prion disease vpc05022   Pathways of neurodegeneration - multiple diseases vpc05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:vpc00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     102545422 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     102545422 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     102545422 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     102545422 (SOD1)    05014 Amyotrophic lateral sclerosis     102545422 (SOD1)    05016 Huntington disease     102545422 (SOD1)    05020 Prion disease     102545422 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     102545422 (SOD1) Enzymes [BR:vpc01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      102545422 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  102545422 NCBI-ProteinID:  XP_031547829 UniProt:  A0A6J3BNK6 LinkDB All DBs Position 1 AA seq 153 aa AA seqDB search MALKAVCVLKGDGQVQGIIHFEQKENGPVVVSGSISGLAEGDHGFHVHQFGDNTQGCTSA GPHFNPLSKKHGGPKDQERHVGDLGNVTAGKDGVAIVSIEDPLISLSGDHSIIGRTMVVH EKPDDLGKGGNEESTKTGNAGSRLACGVIGIAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcgttgaaggctgtgtgcgtgctgaagggcgacggccaggttcagggcatcatccac ttcgagcagaaggaaaatgggccagtcgtggtatcggggtccatttcaggattggctgaa ggcgatcatggattccatgtccatcagtttggagataacacacaaggctgtaccagtgca ggtcctcactttaatcctctatccaaaaaacatggtgggccaaaggatcaagagaggcat gttggagacctgggcaatgtgactgctggcaaagatggtgtggccattgtgtctattgaa gatcctctgatctcactctcaggagaccattccatcattggccgcacaatggtggtccat gaaaaaccagatgacttgggcaaaggtggaaatgaagaaagtacaaagacgggaaatgct ggaagtcgtctggcctgcggcgtgattgggatcgcccaataa

DBGET integrated database retrieval system