Vulpes vulpes (red fox): 112909262 Help Entry 112909262         CDS       T05911                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism vvp  Vulpes vulpes (red fox) Pathway vvp04146   Peroxisome vvp04213   Longevity regulating pathway - multiple species vvp05012   Parkinson disease vvp05014   Amyotrophic lateral sclerosis vvp05016   Huntington disease vvp05020   Prion disease vvp05022   Pathways of neurodegeneration - multiple diseases vvp05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:vvp00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     112909262 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     112909262 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     112909262 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     112909262 (SOD1)    05014 Amyotrophic lateral sclerosis     112909262 (SOD1)    05016 Huntington disease     112909262 (SOD1)    05020 Prion disease     112909262 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     112909262 (SOD1) Enzymes [BR:vvp01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      112909262 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  112909262 NCBI-ProteinID:  XP_025840916 UniProt:  A0A3Q7RFG4 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MEMKAVCVLKGQGPVEGTIHFVQKGSGPVVVSGTITGLTEGEHGFHVHQFGDNTQGCTSA GPHFNPLSKKHGGPKDQERHVGDLGNVTAGKDGVAIVSIEDSLIALSGDYSIIGRTMVVH EKRDDLGKGDNEESTQTGNAGSRLACGVIGIAK NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggagatgaaggccgtgtgcgtgttgaagggccagggcccggtggagggcaccatccac ttcgtgcagaagggaagtgggcctgttgtggtatcaggaaccattacagggctgactgaa ggcgagcatggattccacgtccatcagtttggagataatacacaaggctgtactagtgca ggtcctcactttaatcctctgtccaaaaaacatggtgggccaaaagatcaagagaggcat gttggagacctgggcaatgtgactgctggcaaggatggcgtggccattgtgtccatagaa gattctctgattgcactctcaggagactattccatcattggccgcaccatggtggtccac gagaaacgagatgacttgggcaaaggtgacaatgaagaaagtacacagacaggaaacgcc gggagtcgtttggcttgtggtgtcattgggatcgccaagtaa

DBGET integrated database retrieval system