KEGG   Vulpes vulpes (red fox): 112929340
Entry
112929340         CDS       T05911                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp01524  Platinum drug resistance
vvp04010  MAPK signaling pathway
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04022  cGMP-PKG signaling pathway
vvp04024  cAMP signaling pathway
vvp04062  Chemokine signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04068  FoxO signaling pathway
vvp04071  Sphingolipid signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04114  Oocyte meiosis
vvp04140  Autophagy - animal
vvp04148  Efferocytosis
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04210  Apoptosis
vvp04218  Cellular senescence
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04270  Vascular smooth muscle contraction
vvp04350  TGF-beta signaling pathway
vvp04360  Axon guidance
vvp04370  VEGF signaling pathway
vvp04371  Apelin signaling pathway
vvp04380  Osteoclast differentiation
vvp04510  Focal adhesion
vvp04520  Adherens junction
vvp04540  Gap junction
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04611  Platelet activation
vvp04613  Neutrophil extracellular trap formation
vvp04620  Toll-like receptor signaling pathway
vvp04621  NOD-like receptor signaling pathway
vvp04625  C-type lectin receptor signaling pathway
vvp04650  Natural killer cell mediated cytotoxicity
vvp04657  IL-17 signaling pathway
vvp04658  Th1 and Th2 cell differentiation
vvp04659  Th17 cell differentiation
vvp04660  T cell receptor signaling pathway
vvp04662  B cell receptor signaling pathway
vvp04664  Fc epsilon RI signaling pathway
vvp04666  Fc gamma R-mediated phagocytosis
vvp04668  TNF signaling pathway
vvp04713  Circadian entrainment
vvp04720  Long-term potentiation
vvp04722  Neurotrophin signaling pathway
vvp04723  Retrograde endocannabinoid signaling
vvp04724  Glutamatergic synapse
vvp04725  Cholinergic synapse
vvp04726  Serotonergic synapse
vvp04730  Long-term depression
vvp04810  Regulation of actin cytoskeleton
vvp04910  Insulin signaling pathway
vvp04912  GnRH signaling pathway
vvp04914  Progesterone-mediated oocyte maturation
vvp04915  Estrogen signaling pathway
vvp04916  Melanogenesis
vvp04917  Prolactin signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp04921  Oxytocin signaling pathway
vvp04926  Relaxin signaling pathway
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp04929  GnRH secretion
vvp04930  Type II diabetes mellitus
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04934  Cushing syndrome
vvp04935  Growth hormone synthesis, secretion and action
vvp04960  Aldosterone-regulated sodium reabsorption
vvp05010  Alzheimer disease
vvp05020  Prion disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05034  Alcoholism
vvp05132  Salmonella infection
vvp05133  Pertussis
vvp05135  Yersinia infection
vvp05140  Leishmaniasis
vvp05142  Chagas disease
vvp05145  Toxoplasmosis
vvp05152  Tuberculosis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05171  Coronavirus disease - COVID-19
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05207  Chemical carcinogenesis - receptor activation
vvp05208  Chemical carcinogenesis - reactive oxygen species
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05216  Thyroid cancer
vvp05218  Melanoma
vvp05219  Bladder cancer
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05230  Central carbon metabolism in cancer
vvp05231  Choline metabolism in cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
vvp05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112929340 (MAPK3)
   04012 ErbB signaling pathway
    112929340 (MAPK3)
   04014 Ras signaling pathway
    112929340 (MAPK3)
   04015 Rap1 signaling pathway
    112929340 (MAPK3)
   04350 TGF-beta signaling pathway
    112929340 (MAPK3)
   04370 VEGF signaling pathway
    112929340 (MAPK3)
   04371 Apelin signaling pathway
    112929340 (MAPK3)
   04668 TNF signaling pathway
    112929340 (MAPK3)
   04066 HIF-1 signaling pathway
    112929340 (MAPK3)
   04068 FoxO signaling pathway
    112929340 (MAPK3)
   04072 Phospholipase D signaling pathway
    112929340 (MAPK3)
   04071 Sphingolipid signaling pathway
    112929340 (MAPK3)
   04024 cAMP signaling pathway
    112929340 (MAPK3)
   04022 cGMP-PKG signaling pathway
    112929340 (MAPK3)
   04151 PI3K-Akt signaling pathway
    112929340 (MAPK3)
   04150 mTOR signaling pathway
    112929340 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112929340 (MAPK3)
   04148 Efferocytosis
    112929340 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    112929340 (MAPK3)
   04210 Apoptosis
    112929340 (MAPK3)
   04218 Cellular senescence
    112929340 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112929340 (MAPK3)
   04520 Adherens junction
    112929340 (MAPK3)
   04540 Gap junction
    112929340 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    112929340 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112929340 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112929340 (MAPK3)
   04613 Neutrophil extracellular trap formation
    112929340 (MAPK3)
   04620 Toll-like receptor signaling pathway
    112929340 (MAPK3)
   04621 NOD-like receptor signaling pathway
    112929340 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    112929340 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    112929340 (MAPK3)
   04660 T cell receptor signaling pathway
    112929340 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    112929340 (MAPK3)
   04659 Th17 cell differentiation
    112929340 (MAPK3)
   04657 IL-17 signaling pathway
    112929340 (MAPK3)
   04662 B cell receptor signaling pathway
    112929340 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    112929340 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    112929340 (MAPK3)
   04062 Chemokine signaling pathway
    112929340 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112929340 (MAPK3)
   04929 GnRH secretion
    112929340 (MAPK3)
   04912 GnRH signaling pathway
    112929340 (MAPK3)
   04915 Estrogen signaling pathway
    112929340 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    112929340 (MAPK3)
   04917 Prolactin signaling pathway
    112929340 (MAPK3)
   04921 Oxytocin signaling pathway
    112929340 (MAPK3)
   04926 Relaxin signaling pathway
    112929340 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    112929340 (MAPK3)
   04919 Thyroid hormone signaling pathway
    112929340 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    112929340 (MAPK3)
   04916 Melanogenesis
    112929340 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112929340 (MAPK3)
   04270 Vascular smooth muscle contraction
    112929340 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112929340 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    112929340 (MAPK3)
   04725 Cholinergic synapse
    112929340 (MAPK3)
   04726 Serotonergic synapse
    112929340 (MAPK3)
   04720 Long-term potentiation
    112929340 (MAPK3)
   04730 Long-term depression
    112929340 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    112929340 (MAPK3)
   04722 Neurotrophin signaling pathway
    112929340 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    112929340 (MAPK3)
   04380 Osteoclast differentiation
    112929340 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112929340 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112929340 (MAPK3)
   05206 MicroRNAs in cancer
    112929340 (MAPK3)
   05205 Proteoglycans in cancer
    112929340 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    112929340 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    112929340 (MAPK3)
   05203 Viral carcinogenesis
    112929340 (MAPK3)
   05230 Central carbon metabolism in cancer
    112929340 (MAPK3)
   05231 Choline metabolism in cancer
    112929340 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112929340 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112929340 (MAPK3)
   05212 Pancreatic cancer
    112929340 (MAPK3)
   05225 Hepatocellular carcinoma
    112929340 (MAPK3)
   05226 Gastric cancer
    112929340 (MAPK3)
   05214 Glioma
    112929340 (MAPK3)
   05216 Thyroid cancer
    112929340 (MAPK3)
   05221 Acute myeloid leukemia
    112929340 (MAPK3)
   05220 Chronic myeloid leukemia
    112929340 (MAPK3)
   05218 Melanoma
    112929340 (MAPK3)
   05211 Renal cell carcinoma
    112929340 (MAPK3)
   05219 Bladder cancer
    112929340 (MAPK3)
   05215 Prostate cancer
    112929340 (MAPK3)
   05213 Endometrial cancer
    112929340 (MAPK3)
   05224 Breast cancer
    112929340 (MAPK3)
   05223 Non-small cell lung cancer
    112929340 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112929340 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    112929340 (MAPK3)
   05161 Hepatitis B
    112929340 (MAPK3)
   05160 Hepatitis C
    112929340 (MAPK3)
   05171 Coronavirus disease - COVID-19
    112929340 (MAPK3)
   05164 Influenza A
    112929340 (MAPK3)
   05163 Human cytomegalovirus infection
    112929340 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112929340 (MAPK3)
   05165 Human papillomavirus infection
    112929340 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112929340 (MAPK3)
   05135 Yersinia infection
    112929340 (MAPK3)
   05133 Pertussis
    112929340 (MAPK3)
   05152 Tuberculosis
    112929340 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112929340 (MAPK3)
   05140 Leishmaniasis
    112929340 (MAPK3)
   05142 Chagas disease
    112929340 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112929340 (MAPK3)
   05020 Prion disease
    112929340 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    112929340 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    112929340 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    112929340 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112929340 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112929340 (MAPK3)
   04934 Cushing syndrome
    112929340 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112929340 (MAPK3)
   01524 Platinum drug resistance
    112929340 (MAPK3)
   01522 Endocrine resistance
    112929340 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112929340 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vvp03036]
    112929340 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vvp04147]
    112929340 (MAPK3)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112929340 (MAPK3)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112929340 (MAPK3)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     112929340 (MAPK3)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112929340 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Choline_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 112929340
NCBI-ProteinID: XP_025867177
UniProt: A0A3Q7U1D8
LinkDB
Position
Unknown
AA seq 364 aa
GADGVGPGVSGEVEVVKGQPFDVGPRYTELHYIGEGAYGMVSSAYDHVRKVRVAIKKISP
FEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLDAMRDVYIVQDLMETDLYKLLKS
QQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEH
DHTGFLTEYVAPRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLN
HILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNP
NKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLKELIFQETARFQPGV
LEAP
NT seq 1095 nt   +upstreamnt  +downstreamnt
ggagccgatggggtcggcccgggggtctcgggggaggtggaggtggtgaaggggcagccg
ttcgacgtgggcccgcgctacacggagctgcactacatcggcgagggcgcgtacggcatg
gtcagctcagcttatgaccacgtgcgcaaggttcgcgtggccatcaagaaaatcagcccc
tttgagcatcagacctactgccagcgcacactgagggagatccagatcttgctgcgcttc
cgccatgagaacgtcattggcattcgggacattctgcgggcacccaccctggacgccatg
agggatgtctacatcgtgcaggacctgatggagacagacctatacaagttgctcaaaagc
cagcagctgagcaacgaccatgtttgctacttcctctaccagatcctgcgaggcctcaag
tatatccactcagccaatgtgctccaccgggatttaaagccctctaacctgctcatcaac
accacctgcgaccttaagatctgcgattttggcctggcccggattgccgatcctgagcat
gaccacactggcttcctgacagaatatgtggccccgcgctggtaccgggctccagaaatc
atgcttaactctaagggctacaccaagtccatcgacatctggtctgtgggctgcattctg
gctgagatgctctccaaccggcccatcttccctggcaagcactacctggaccagctcaac
cacattctaggtatcctaggctccccatcccaggaggacttgaactgtatcatcaatatg
aaggcccgaaactacctacagtctctgccctccaagaccaaggtggcatgggccaagctt
tttcccaagtcagactccaaagcccttgacctgctagaccggatgttgacctttaacccc
aacaaacggattacagtggaagaagcactggctcatccctacttggagcagtactacgac
ccaacagatgagccagtggctgaggagcctttcactttcgacatggagctggatgatcta
cccaaggagcgtctgaaggagctcatcttccaggagacagcccgcttccagcctggggtg
ctggaagccccctag

DBGET integrated database retrieval system