Xanthomonas sp. GW: HEP73_03639 Help Entry HEP73_03639       CDS       T08755                                  Name (GenBank) DNA polymerase III subunit chi   KO K02339   DNA polymerase III subunit chi [EC:2.7.7.7] Organism xag  Xanthomonas sp. GW Pathway xag03030   DNA replication xag03430   Mismatch repair xag03440   Homologous recombination Brite KEGG Orthology (KO) [BR:xag00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     HEP73_03639    03430 Mismatch repair     HEP73_03639    03440 Homologous recombination     HEP73_03639  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:xag03032]     HEP73_03639    03400 DNA repair and recombination proteins [BR:xag03400]     HEP73_03639 Enzymes [BR:xag01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      HEP73_03639 DNA replication proteins [BR:xag03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      HEP73_03639 DNA repair and recombination proteins [BR:xag03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      HEP73_03639 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol3_chi Motif Other DBs NCBI-ProteinID:  QNH22691 UniProt:  A0A7G7T121 LinkDB All DBs Position 4281776..4282198 Genome browser AA seq 140 aa AA seqDB search MRADFYLIAKPRFLTEPLRLVCELARKANDANLWTLVLARDEAQAEELDELLWAFDPDAY IPHQIAGADVDEEEAQVLIVPPGVEAPSRALVINLRDDAYLGTCERVLEVVPADPAAREP LRERWKQYKALGFEVSKYDM NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgcgcgccgatttctacctgatcgccaagccgcgcttcctcaccgagccgctgcggctg gtctgcgagctggcgcgcaaggccaacgacgccaacctgtggacgttggtgctggcgcgc gacgaggcgcaggccgaggagctggacgagctgttgtgggcgttcgacccggatgcctac atcccgcaccagatcgccggcgccgatgtcgacgaggaagaggcgcaggtgctgatcgtc ccgcccggcgtggaagcgccgtcgcgcgcgctggtgatcaacctgcgcgacgacgcctac ctcggtacctgcgagcgcgtgctggaagtggtgccggccgaccccgccgcgcgcgagccg ctgcgcgaacgctggaaacagtacaaggcgctgggcttcgaggtcagcaagtacgacatg tga

DBGET integrated database retrieval system