Xiphophorus hellerii (green swordtail): 116716175 Help Entry 116716175         CDS       T07363                                  Symbol tmsb4x Name (RefSeq) thymosin beta-4   KO K05764   thymosin, beta 4 Organism xhe  Xiphophorus hellerii (green swordtail) Pathway xhe04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:xhe00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     116716175 (tmsb4x)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:xhe04812]     116716175 (tmsb4x) Cytoskeleton proteins [BR:xhe04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      116716175 (tmsb4x) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thymosin Motif Other DBs NCBI-GeneID:  116716175 NCBI-ProteinID:  XP_032412951 LinkDB All DBs Position 24:complement(2030466..2032759) Genome browser AA seq 42 aa AA seqDB search MSDKPDISEVTSFDKSKLKKTETQEKNPLPTKETIEQEKQAS NT seq 129 nt NT seq  +upstreamnt  +downstreamnt atgagtgacaagcccgacatctcagaggtgaccagctttgacaagtccaagctgaagaag acagagacgcaggagaagaaccccctgcctacgaaagagaccattgaacaggagaagcaa gcatcatga

DBGET integrated database retrieval system