Yersinia enterocolitica FORC_002: FORC2_1656 Help Entry FORC2_1656        CDS       T03890                                  Name (GenBank) damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism yef  Yersinia enterocolitica FORC_002 Brite KEGG Orthology (KO) [BR:yef00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:yef03400]     FORC2_1656 DNA repair and recombination proteins [BR:yef03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     FORC2_1656 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI DUF5388 Motif Other DBs NCBI-ProteinID:  AKF37803 UniProt:  A0A0E1NJ49 LinkDB All DBs Position complement(1894876..1895121) Genome browser AA seq 81 aa AA seqDB search MRVEVSIDKKNQLPAGAIEALTNELSKRLNTKFPDTTTAVQVRYAGANNLSVLGGAKTDK DLISEILQEIWESADDWFDAE NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgtgttgaagtcagtattgataaaaaaaatcagttacccgcaggtgctatcgaagca ctcaccaatgaattgagtaaacgactgaatactaaattcccggataccactaccgcagta caagtgcgttatgctggggccaataatctttctgttttaggtggtgccaaaactgataaa gatctcatctctgaaatattacaagaaatatgggaaagtgcagatgattggttcgatgcc gaataa

DBGET integrated database retrieval system