Yersinia pseudotuberculosis EP2/+: BZ20_2059 Help Entry BZ20_2059         CDS       T03678                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism ypr  Yersinia pseudotuberculosis EP2/+ Brite KEGG Orthology (KO) [BR:ypr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ypr03110]     BZ20_2059 (grxC) Chaperones and folding catalysts [BR:ypr03110]  Protein folding catalysts   Protein disulfide isomerase    BZ20_2059 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like SH3BGR GST_N Thioredoxin_3 Motif Other DBs NCBI-ProteinID:  AJJ07467 UniProt:  A0A0T9KQE9 LinkDB All DBs Position complement(2318125..2318373) Genome browser AA seq 82 aa AA seqDB search MAKIEMYTKATCPFCHRAKALLNAKGAAFHEIAIDNDPAKREEMIARSGRTTVPQIFIDG QHIGGCDDLHALDARGGLDPLL NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcgaagattgagatgtataccaaagcaacatgcccgttctgtcaccgtgctaaagca ctgctgaacgccaagggtgctgctttccatgaaatcgcaatagataatgatccggccaaa cgcgaagagatgattgctcgtagtgggcggacgacggtgcctcagatatttattgatggg cagcatatcggtggctgtgatgatttacacgccctggatgcgcgcggtgggctagaccca ctgctttaa

DBGET integrated database retrieval system