KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_1618
Entry
Aaci_1618         CDS       T00985                                 

Definition
(GenBank) 4-oxalocrotonate decarboxylase
  KO
K01617  2-oxo-3-hexenedioate decarboxylase [EC:4.1.1.77]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac00362  Benzoate degradation
aac00621  Dioxin degradation
aac00622  Xylene degradation
aac01100  Metabolic pathways
aac01120  Microbial metabolism in diverse environments
aac01220  Degradation of aromatic compounds
Module
aac_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:aac00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Aaci_1618
   00622 Xylene degradation
    Aaci_1618
   00621 Dioxin degradation
    Aaci_1618
Enzymes [BR:aac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.77  2-oxo-3-hexenedioate decarboxylase
     Aaci_1618
SSDB
Motif
Pfam: FAA_hydrolase
Other DBs
NCBI-ProteinID: ACV58630
UniProt: C8WX08
LinkDB
Position
complement(1689336..1690115)
AA seq 259 aa
MALSLPSIADELYRHQTTATELKKLTLRYDGLTVDDAYEIQRLTMQKYMAEGARLVGWKM
GLTSKAKQRSVGVDEPIFGHLLSTMELERPVLSMQGLIHPRVEPEIAFVFRSRLEGPNVT
ARDVWLATECVVPAVEVIDSRYENFSFTLVDVIADNASSARFYLADQAYSPYAFRLDEVG
VVMRLNGEVAQTGAGAAVLGHPVRSVVEQVRMLTRFGAAIEPGMVVLTGGITEAIYVHPG
DRVEIAFAGMGAIELDVIE
NT seq 780 nt   +upstreamnt  +downstreamnt
atggccctgtcgcttccgtccatcgcggatgagctgtatcgccaccagacgacggccacg
gagttgaagaagctgacgcttcgctacgacgggctcacggtggacgacgcgtatgagatc
cagcgcttgaccatgcagaagtacatggcggagggggcgcggctcgtcggctggaagatg
gggctcacgagcaaggcgaagcagcggtccgtgggcgtggatgaacccattttcggacac
ctcctttccacgatggaactggagcgcccggtgttgtcgatgcagggactcatccatccg
cgcgtggagccggagatcgcgttcgtgttccgcagccgcttggaggggccgaatgtgacc
gcgcgcgacgtgtggctcgcgaccgagtgcgtcgtccctgcagtcgaggtcatcgacagc
cggtacgagaacttctccttcacgctcgtggacgtgatcgccgacaacgcgtcgagcgcg
cgcttctatctggcggatcaggcgtactcgccgtacgcatttcggctcgacgaggtgggg
gtggtgatgcgcctgaacggggaagtcgcgcagacgggcgcgggcgcggcggtgctcggc
cacccggtgcggtccgtcgtggaacaggtgcgcatgctcacgcgcttcggcgcggccatc
gagcccggcatggtggtcctgacgggcggcatcacggaggccatctacgtgcacccgggc
gatcgcgtcgagatcgccttcgcgggcatgggcgcaatcgaactggacgtcatcgagtga

DBGET integrated database retrieval system