KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2330Help
Entry
Aaci_2330         CDS       T00985                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac00040  Pentose and glucuronate interconversions
aac00051  Fructose and mannose metabolism
aac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Aaci_2330
   00051 Fructose and mannose metabolism
    Aaci_2330
Enzymes [BR:aac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Aaci_2330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 TP_methylase AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ACV59337
UniProt: C8WRS6
LinkDB All DBs
Position
complement(2392859..2393917)
Genome map
AA seq 352 aa AA seqDB search
MAVSSAIPKTMKAAYLVGTRQVEVREVPVPEPSPDDALIRVEAVGVCGSDVHYYEHGRIG
RYVVDGPLILGHEASGVVVAVGANVKHLRPGQRVAIEPGVTCGRCDFCKSGRYNLCPHVR
FLATPPVDGAFAQYIAHRADFVHPIPDDMSYEQAAMVEPFSVALHAIRRSGMRPGDRVAI
AGMGPVGLFTVVAARRLGAGDVVVSDTVEKRLQLALQLGATEAVHAKRGAIADAVRERFP
DGVDVAIETAGHPDAVASLLPALRRGGRLVVVGLSQSPLKELDLTQLTDGEIEIAGVFRY
ANTYPAGIQLMREIDVWDLITDTFPLAEAGDALERARTNKSESIKVVVYPQA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtgtcgagcgccattcccaagacgatgaaagcggcgtacctcgtcggcacgcgg
caggtggaggtccgcgaggttccggtgcccgagccctcgccggacgacgcgctgattcgg
gtggaggcggtcggggtgtgcggctccgacgtgcactactacgaacacggtcggatcggc
aggtacgtggtcgacggcccgctcattctgggccacgaggcaagcggcgtcgtcgtggcc
gtcggcgcgaacgtgaagcatctgcgcccgggtcagcgcgtcgccatcgagcccggcgtg
acctgcgggcggtgcgacttttgcaaatcggggcggtacaacctgtgcccgcacgtccgc
ttcctcgcgacgccgcccgtcgacggcgcgttcgcccagtacatcgcccaccgcgcggac
ttcgtccatcccatcccggacgacatgtcgtacgaacaggcggcgatggtcgagccgttc
tccgtcgcgcttcacgccatccgccgatccggcatgcgccctggggatcgcgtcgccatc
gcggggatggggcccgtgggcctcttcacggtggtcgcggcgcggcggcttggcgcgggc
gacgtggtggtcagcgatacggtggagaagcggcttcagctcgcgctccagctcggggcc
acggaggcggtgcacgcgaagcggggcgccatcgcggacgcggttcgcgagcggtttcct
gacggcgtcgacgtggccatcgagacggccggccacccagacgcggtggcatccctcttg
ccggcgctgcgccgcggcgggcggctcgtggtggtgggcctgtcgcagtcgccgctcaag
gaactcgatctgacgcagcttacggacggcgagatcgagatcgcgggcgtgttccgatac
gccaacacgtatcccgcgggtatccagctcatgcgcgagatcgacgtctgggatcttatc
accgacacgtttccgctcgcggaggccggggacgccctcgagcgtgcgcggacgaacaag
agcgagagcatcaaggtcgtcgtctacccgcaggcgtga

DBGET integrated database retrieval system