KEGG   Aedes aegypti (yellow fever mosquito): 23687986Help
Entry
23687986          CDS       T01053                                 

Definition
(RefSeq) DNA ligase 1 isoform X2
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag03030  DNA replication
aag03410  Base excision repair
aag03420  Nucleotide excision repair
aag03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:aag00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    23687986
   03410 Base excision repair
    23687986
   03420 Nucleotide excision repair
    23687986
   03430 Mismatch repair
    23687986
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aag03032]
    23687986
   03400 DNA repair and recombination proteins [BR:aag03400]
    23687986
Enzymes [BR:aag01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     23687986
    6.5.1.6  DNA ligase (ATP or NAD+)
     23687986
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     23687986
DNA replication proteins [BR:aag03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    23687986
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     23687986
DNA repair and recombination proteins [BR:aag03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     23687986
   NER (nucleotide excision repair)
    Other NER factors
     23687986
   MMR (mismatch excision repair)
    Other MMR factors
     23687986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 23687986
NCBI-ProteinID: XP_011493575
UniProt: J9HJ51
LinkDB All DBs
Position
1
AA seq 905 aa AA seqDB search
MSQKSILSFFAKTNAKKADDESLAGQQEKSGKEKRRSDGEADNNNAVSKKASTVKSEDED
SPMKRSGGTGRKSGAVFDSSPEASPEKKSVDAKTNGGGSVPKRRRIASSSEEEAGGSPKK
SSPKKVDEENPIKKEKPSPKVKPKSESKPKKDEKKSPKSSAKKSSPKEKKAVKEEKPTES
KDKEVKEVKKEAESPKDKEVKDVKREAESPKKDTKPVDVKDKTANVMSFFTSAGKKDTGS
SSGSKVDGADYNPGKKNYHPINDAFWKKGDKVPYLALARTFQIIEETSGRLRMIEILSNY
FRSVILLSPSDLLASVYLSLNQLAPAYEGVELGIAEHTLMKAIAQSTGRSLAQIKTDAQN
TGDLGLVAEQSKSSQRMMFRPAPHSVEGVFGKLKEIAKMTGAASMAKKVDKIQSMFVACR
HSEARFIIRSLAGKLRIGLAEQSLLQALAQACAMTPPNQKDCKEPIVNALSKCSEATAKA
KVDEIALILKTVYCQCPNYNQIVPVLLEHGIDHLLEKCPMMPGTPLKPMLAHPTKGVQEV
LERFDGIDFTCEWKYDGERAQIHLLEDGTVNIYSRNQENNTSKYPDIIARLGNTRKESVT
TAILDCEAVAWDPEKKQILPFQILSTRKRKDANEADIKVQVCVYMFDLLYLNGKPLVERP
FLERRELMYKHFIEFEGEWKYATRLDTGDIDELQRFLDEAVKGNCEGLMVKTLQKEATYE
IAKRSRNWLKLKKDYLSGVGDSLDLVVIGGYKGRGKRTGTYGGFLLACYDEDNEEYQSIC
KIGTGFSDEDLQTHTDFFKDKIIPRAKNYYRYDPSHEPDDWFEPAQVWEVLCADLSLSPV
HRAGQGIIDPEKGISLRFPRFIKIRDDKGTTDATSAKQVADMYMNQDQIKNQQQNNQRDP
EEDFY
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaaaatcaatattatcatttttcgccaaaaccaacgccaagaaagcggatgac
gaatcgttggccggtcagcaggaaaagagcggaaaggagaagcgacgttccgacggcgaa
gcggacaataacaatgcggttagcaaaaaggcatcgaccgttaaatccgaagatgaggac
agtccgatgaagcgttccggagggactggacggaagtcgggtgccgtgttcgattcgtct
ccggaggcgtccccggagaagaaatcggtcgatgcgaagacgaacggaggtgggagtgtc
cccaagcgaaggcgcattgcctcgtccagtgaggaggaagcaggaggatcgcccaagaag
tccagtccaaagaaagtggatgaggagaaccccatcaagaaggagaagcctagtccgaaa
gtgaaacccaagtcggaatcgaaacctaaaaaagacgaaaagaaatcccccaaatcttcg
gcgaagaagagctccccgaaagagaagaaagcggtaaaagaggagaagccgactgagagc
aaggacaaggaagtgaaggaagttaagaaggaagccgaatcgcccaaagacaaagaagtg
aaggatgtcaagagggaagctgaatcgcccaagaaggacactaaaccggtggacgtgaag
gacaaaactgcgaacgtgatgagtttcttcaccagtgccggaaagaaagataccggttcc
agcagcggttccaaagtggatggcgccgattacaatccgggcaagaaaaactaccatccg
atcaacgacgccttctggaagaagggtgacaaagtaccgtacttggctttggccaggact
ttccagataatcgaagaaaccagcgggcggttgcggatgatagagattctgagtaactac
ttccgatcggtgattttgctcagtccgagcgatttgctggcgagcgtctatctcagtctg
aatcagttggccccggcttacgagggcgttgagctgggtattgcggagcatacgctgatg
aaggccattgcccagagtacgggacgaagtctggcccagatcaagaccgatgctcagaat
acgggagacttgggactggtggccgagcagtcgaagagtagtcaacggatgatgttccgt
ccggcgccccattcggtggaaggcgtctttgggaagcttaaggaaatcgcgaagatgacc
ggagccgcttccatggccaagaaggtcgacaagatccaatcgatgtttgttgcatgccgt
cactcggaagctcgtttcatcattcgctcgctggccgggaagctgcggataggtctggcg
gagcagtctttactgcaggcgttggctcaagcatgtgccatgactccacccaaccagaaa
gattgcaaagaacccatagtgaacgcgctgagcaagtgcagtgaagcaacggccaaggcc
aaagtcgacgaaatcgccctgatcctgaaaacggtgtactgtcagtgcccgaactacaac
caaattgtcccggtgctgctggaacacggcattgatcacttgctagagaaatgcccaatg
atgccgggaactcctctcaaacctatgttggcccatcccacgaaaggtgttcaggaagtt
ctggagcgattcgatggaatcgacttcacctgcgagtggaaatacgacggggaacgagct
cagatccatctgctggaggatggcaccgttaacatctatagccgtaatcaggagaacaac
accagcaagtatccggacatcatcgcgcggttaggcaacacccgcaaggaatctgtaacc
accgccatcctggattgcgaagccgtagcttgggatccggagaagaagcaaatccttccc
ttccaaatcctcagcacccggaagcgaaaggacgccaacgaagcggacatcaaggtccag
gtgtgcgtctacatgttcgatctgctgtatctgaacggtaagcccctcgtcgagcggcca
ttcctggagcgacgagaactaatgtacaagcacttcatcgagttcgaaggcgagtggaag
tacgctacccgtctggacaccggcgacattgacgaactgcagcgcttcctggacgaagcc
gtcaagggcaactgcgaaggactcatggtcaaaaccctccagaaggaagccacctacgaa
atcgccaaacgctcccgcaattggctcaagctcaaaaaggattacctctcgggggtggga
gattctctggatctggtcgtaatcggaggctacaagggcaggggcaagcgaaccggcacc
tacggaggtttcctccttgcttgctacgacgaagacaacgaagagtatcagagcatctgc
aaaattggaaccggattctccgacgaggacctccaaacgcacacggacttcttcaaggac
aaaatcataccccgggccaagaactactaccgctacgatccatcacacgaaccggacgac
tggttcgagccggcccaggtctgggaggtgctctgtgccgatctgtcgctgagtccggtg
catcgggccggccagggcatcatcgatccggagaagggcatctcgctgcgcttcccgcgc
ttcatcaagatccgcgacgataagggaacgacggatgccacctcggccaaacaggtcgcc
gacatgtacatgaaccaggaccagatcaagaatcagcagcagaacaatcagcgggacccc
gaagaggacttctactag

DBGET integrated database retrieval system