KEGG   Aedes aegypti (yellow fever mosquito): 5573744Help
Entry
5573744           CDS       T01053                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag04146  Peroxisome
aag04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:aag00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    5573744
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    5573744
Enzymes [BR:aag01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     5573744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 5573744
NCBI-ProteinID: XP_001654772
UniProt: Q1HRN3
LinkDB All DBs
Position
3
AA seq 153 aa AA seqDB search
MPAKAVCVLSGDVKGTIFFQQNGDSDPVKVTGEVTGLKPGNHGFHIHEFGDNTNGCTSAG
PHFNPHGKEHGGPDAAERHAGDLGNVVADGSGVAKVDISDSQISLSGPLSILGRTVVVHA
DPDDLGLGGHELSKSTGNAGARLACGVIGICKA
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgccggctaaagcagtttgtgttctgagcggcgatgtcaagggcaccatctttttccag
caaaatggagattcggatccggtgaaggttactggcgaagtgaccggactgaagccgggc
aaccatggattccacatccacgagttcggtgacaacaccaacggatgcacctcggctgga
ccgcacttcaacccgcacggcaaggagcacggtggccccgatgccgccgaaagacacgcc
ggagacttgggcaacgttgtcgccgatggcagcggagtcgccaaggtcgatatctccgac
agtcagatttccttgtccggaccgctgagcatcctgggacgcactgtggtcgtgcatgcc
gatcctgatgatttgggcctgggtggacacgaattgagcaagtctaccggaaacgccggt
gctcgtctggcttgcggtgtcattgggatttgcaaagcataa

DBGET integrated database retrieval system