KEGG   Apteryx australis mantelli (brown kiwi): 106482030Help
Entry
106482030         CDS       T04298                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam03030  DNA replication
aam03410  Base excision repair
aam03420  Nucleotide excision repair
aam03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:aam00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    106482030 (LIG1)
   03410 Base excision repair
    106482030 (LIG1)
   03420 Nucleotide excision repair
    106482030 (LIG1)
   03430 Mismatch repair
    106482030 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aam03032]
    106482030 (LIG1)
   03400 DNA repair and recombination proteins [BR:aam03400]
    106482030 (LIG1)
Enzymes [BR:aam01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     106482030 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     106482030 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     106482030 (LIG1)
DNA replication proteins [BR:aam03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    106482030 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     106482030 (LIG1)
DNA repair and recombination proteins [BR:aam03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     106482030 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     106482030 (LIG1)
   MMR (mismatch exicision repair)
    Other MMR factors
     106482030 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 106482030
NCBI-ProteinID: XP_013794996
LinkDB All DBs
Position
Un
AA seq 857 aa AA seqDB search
VLEQGENPTQEPPSLGHEDCDGQDPSSPSSCLLAAASPDGSSPDSASSAEDSPSAPDGSS
TSLPGIPRRRTARKQVPKRKMELASCAENGHAVDPDPKRWREEPGDECESDSTEAQEVRD
QSSEEAKEAEDGNGDREAQTSELPKPSKAVADFFAPRKGSRMKAEENAAPKTPAPKGSAP
ASIDGTNGTASSPSQVAEPLDPAQYNPSKSSYHPIHDACWAPGQRVPYLAVARTFERIEE
VSARLKNIETLSNFLRSVIALSPSDLLACVYLCLNRLGPAYEGLELGIGESILMKAVAQA
TGRQLEKIKSEAQEKGDLGLVAESSRSNQRTMFAPPKLSAAGVLSKLQEMARMTGNASMN
KKIDIIKALFVACRHSEARYIARSLSGKLRIGLAEQSVLVALAHAVSLTPPAQGWPPAVV
DASQGKSAEARKAWLEERSQILKQTFCELPNYAAIIPVLLEHGLESLPLHCKITPGIPLK
PMLAQPTKGIGELLKRFEEAAFTCEYKYDGERAQIHILESGAVYVYSRNQENTTSKYPDI
VTRIPKVKKASVQSCILDAEAVAWDPEKKQIQPFQVLMTRKRKDVEAAEIKVQVCLYAFD
MLYLNGESLVKEPFSKRRLLLHESFVETEGEFLFATSMDACSTDEISEFLDQSIKDSCEG
LMVKTLDVDATYEIAKRSHKWLKLKKDYLEGVGDTLDLVVIGAYLGKGKRVGMYGGFLLA
CYDEESEEYQSICKIGTGFTEESLEKHYGFLKDHVLAQPRPYYRWDSGAAPDHWLAAVQV
WEVKCGDLSISPVYKAAVGLVDEEKGISLRFPRFLRVREDKKPEEATSSSQVAELYKKQQ
QIQNQQLAEKGEDEDFY
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
gtgctggagcagggcgagaaccccacgcaggagcccccatccctgggacatgaggactgt
gatgggcaggaccccagctccccgtcctcctgcctgctggctgctgcgtccccggatggc
tcttctcccgacagtgcttcctcagctgaagatagcccctcagcccctgatggctcctcc
acctccctccctggcatcccccggcgcaggacagctcgtaagcaggtccccaagcgcaaa
atggagctggcgagctgtgcggagaatggacatgctgtggaccccgatcccaagcggtgg
agggaagagccgggagatgaatgtgaatcagacagcacggaggcgcaggaggtgagggat
cagagctcagaggaggctaaggaggcagaagatggcaatggggacagggaagcccagacg
tcagagctgccaaagcccagcaaagctgttgctgacttctttgcccccaggaaggggtcg
aggatgaaggcagaggaaaatgctgccccgaagacaccagccccaaagggttcggctccc
gccagcattgatggcaccaacgggactgcaagcagtccctcccaggttgccgagcctctg
gatccagcccagtacaacccctctaagagcagctatcaccccattcatgacgcctgctgg
gctcccgggcagagggtcccctacctggctgtggctcgtacctttgagcgcattgaggaa
gtctctgcccgcctgaagaacattgagaccctgagcaacttcctccgctcagtcattgcc
ctgtcaccgtctgacctcctggcctgtgtctacctctgcctgaaccgcctgggccctgcc
tatgaggggctggagctgggcattggggaaagcatcctcatgaaggctgttgcgcaggcc
acaggccgccagctagaaaaaatcaagagcgaggcccaggagaagggagacctggggctg
gtggccgagagcagccgcagcaaccagcggaccatgttcgcgccacccaagctgagcgct
gccggggtcctcagcaagctgcaggagatggccaggatgacaggcaatgcttcaatgaac
aagaaaatcgatatcatcaaggcattgtttgtggcctgccgccactccgaggctcgctac
attgcccggtcgttgagcgggaagctgcgcatcgggctggcggagcagtcggtgctggtg
gctttggcccacgctgtctcactgactcctccagcacaagggtggcccccagctgtggtg
gatgccagccagggcaagtctgctgaagcacgtaaagcctggctggaagagcggagccag
atcctcaagcagactttttgtgagctgccgaattatgctgccatcattcccgtgctgctg
gagcatgggctggagagcctgcccctgcactgcaagatcaccccagggatccccctgaag
cccatgctggcccagcccaccaaaggcattggggagctcctgaaacgcttcgaggaggcg
gccttcacatgcgagtacaagtacgatggcgagcgagcccagatccacatcctggagagc
ggggccgtgtacgtctacagccgcaaccaggagaacaccacctccaagtaccccgacatc
gtcacccgcatccccaaggtgaagaaggccagtgtgcagtcgtgcatcctggatgcagag
gctgttgcgtgggacccggagaagaagcaaatccagccattccaggtgctgatgacacgg
aagaggaaggatgtggaagctgctgagatcaaagtgcaagtgtgcctgtatgcctttgac
atgctgtacctcaatggggagtcgctggtgaaggagcccttctccaaacgccgcctgctg
ctgcatgagtcctttgtggagacggagggtgaattcctctttgccacctccatggatgcc
tgcagcactgatgaaatctctgagttcttggaccagtccatcaaggactcctgcgagggc
ctcatggtgaagactctggacgtggatgccacctatgaaattgcaaagcgatcccacaag
tggctgaagttgaagaaggattacctggaaggagtgggggacacgctagacttggtggtc
atcggtgcctacctggggaagggcaagcgcgtgggcatgtacgggggcttcctgctggcc
tgctacgatgaggagagtgaagagtaccagagcatctgcaagatcgggaccggcttcaca
gaggagagcctggagaagcactacggcttcctcaaggaccacgtcctggcccagccacgg
ccctactaccgctgggacagtggggcagcgcctgaccactggctggcggctgtgcaggtt
tgggaggtgaagtgtggtgacctctccatctcccctgtctacaaggcagctgtgggcctg
gtggatgaggagaaaggcatctcgctgcgtttcccccggttcctgcgtgtacgagaggac
aagaagccagaagaggccaccagcagctcccaggtggctgagctgtacaagaagcagcag
cagatccagaaccagcagcttgccgagaaaggggaggacgaggacttttactaa

DBGET integrated database retrieval system