KEGG   Apteryx australis mantelli (brown kiwi): 106482891Help
Entry
106482891         CDS       T04298                                 

Gene name
GSTZ1
Definition
(RefSeq) glutathione S-transferase zeta 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00350  Tyrosine metabolism
aam01100  Metabolic pathways
Module
aam_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    106482891 (GSTZ1)
Enzymes [BR:aam01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     106482891 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 106482891
NCBI-ProteinID: XP_013796043
LinkDB All DBs
Position
Un
AA seq 218 aa AA seqDB search
MLNSMDSKPILYSYFRSSCSWRVRIALALKGIAYDQVPVNLLKDGGQQFSAEFKALNPMQ
QVPALKIDGITLSQSLAIIHYLEETRPNPKLLPQGPKKRAQVRMISDHIVSGIQPLQNLS
ILQRMGEKKMEWAQQCITSGFQALEQILQHTAGRYCVGDEVSMADLCLVPQVFNAERYKV
DLSPYPTITRINKALLELEAFKASHPSRQPDTPAELRA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacagtatggacagcaagccgatactttatagctattttcgaagctcctgctct
tggagagtgagaatcgcactggctctgaaagggattgcctatgaccaggtgccagtgaac
ctcctgaaggacggggggcagcagttttctgctgaattcaaggcactgaatccaatgcag
caagtcccagccttgaaaattgatggcatcaccctttctcagtcgctagctataattcat
tacctagaagaaacccggcctaatcccaagctcctgccccaaggtccaaagaagagagcc
caagtcagaatgatctcagatcacattgtctccggcattcagccactccagaacctgagt
atcctgcaacgaatgggggagaaaaaaatggaatgggctcagcaatgcatcacatctggc
ttccaagcactggagcagattctgcagcacactgctgggcgctactgtgtgggggatgag
gtgtccatggctgacttgtgcttggtgcctcaagttttcaatgctgaaagatacaaagtg
gacctgtctccatatcccacaataaccagaatcaacaaagctctcctagagttggaggca
ttcaaagcaagccacccatcccgacagccagatacccctgcagaactgcgagcttaa

DBGET integrated database retrieval system