KEGG   Apteryx mantelli mantelli (brown kiwi): 106500249Help
Entry
106500249         CDS       T04298                                 

Gene name
RNPEP
Definition
(RefSeq) arginyl aminopeptidase
  KO
K01260  aminopeptidase B [EC:3.4.11.6]
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Brite
KEGG Orthology (KO) [BR:aam00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aam01002]
    106500249 (RNPEP)
Enzymes [BR:aam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     106500249 (RNPEP)
Peptidases and inhibitors [BR:aam01002]
 Metallo peptidases
  Family M1
   106500249 (RNPEP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N Sec7 Peptidase_MA_2
Motif
Other DBs
NCBI-GeneID: 106500249
NCBI-ProteinID: XP_013817421
LinkDB All DBs
Position
Un
AA seq 553 aa AA seqDB search
MCQERCFCAWLSVGGPYALFRSDVLAGLFPNCPEGEAFPLYFWLSCAQQVCWLTPEQTAG
KQKPYLYTQGQAVLNRSFFPGFDTPAVKCTYSATVKVPEGFTAVMSATTWEKQEKDNTFI
FKMSQPIPSYLIALAVGDIVSAEVGPRSRVWAEPCLIEAAKKEYDGVIEEFLAVGEKLFG
PYVWGRYDILFMPPSFPFGGMENPCITFVTPCLLAGDRSLVDVIIHEISHSWFGNLVTNA
TWGEFWLNEGFTMYAQRRISTEVYGSAYTCLEAATGRALLRQHMDNTGEDHPLNKLRVII
EPGVNPDDTYNETPYEKGYCFVSYLAHLVGDQSKFDAFLQAYVNQFKFQSITADDALDFF
LEYFPELKKKGVDSLPGFEFDRWLNTPGWPPYLPDLSPGEQLMKPADQLAELWAADSLNM
EAIEAVDISAWKTYQLVYFLDQILQKSPLPEGNVERLSEMYPKISKAQNAELRLRWCQIV
LKNNHECEYSKVKDFLHSQGKQKYTLPIYRAMWSGSESARALAMETFSATAPQLHVNVQN
YVKKILGLEVAEN
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcaagaaaggtgcttttgtgcctggttgtctgtcggagggccgtacgccctattt
cgttcagatgtcctggctggactctttccaaactgcccagaaggagaagcctttccttta
tacttctggctttcctgtgctcaacaggtgtgttggctcactcccgagcagacagcaggg
aagcagaagccctatttgtacactcaaggccaggccgtgctgaatagatcctttttccct
ggctttgacactccagcagttaaatgtacatattcagccacagtgaaggtccccgagggt
ttcacagctgtgatgagtgccacgacctgggagaaacaggagaaggataacaccttcatc
tttaagatgtcccagccaatcccctcctacctgatcgctctggctgtcggggacattgtt
tctgctgaagtcggcccaaggagccgtgtctgggctgagccttgcctgatcgaggctgct
aagaaggaatatgacggggtgattgaggagttcctggcagtcggagagaagctctttgga
ccctatgtttggggcaggtacgacatcctgttcatgccgccctcgttcccctttggtggg
atggagaacccctgcatcacctttgtgacaccctgcctgctggccggggaccgttccctg
gtggatgtcatcatccacgagatctcccacagctggtttggcaacctggtcactaatgcc
acgtggggcgagttctggctgaacgagggcttcaccatgtatgcacagaggcggatttcc
accgaggtctacggttctgcgtacacctgcctggaggctgcaacgggaagggccctgctg
cgccagcacatggacaataccggagaggaccatccgctaaacaagctccgggtgataatc
gagccaggtgtcaacccagatgacacgtacaatgaaactccctacgagaaggggtactgc
tttgtgagctacttggcacatcttgtgggggaccagagcaagttcgatgccttcctccag
gcctacgtgaaccagttcaagttccagagcatcacagcagatgatgcccttgatttcttc
ctggagtacttcccggagctgaagaagaaaggcgtggactccctgccaggctttgagttt
gatcgctggctgaacacgccaggctggcccccttacctgcccgacctctcaccgggggag
cagctgatgaagccggcggaccagctggcagagctctgggcagccgacagcttgaacatg
gaggcgatcgaagcagtggacatctctgcctggaaaacgtaccagctggtctacttcctg
gatcagatcctgcagaaatcccccctgccggaaggcaatgtggagaggctgagcgagatg
taccccaagatctccaaggcccagaacgccgagctgcgtctccgttggtgccagattgtc
ctcaagaacaaccatgagtgcgagtacagcaaggtcaaggacttcctccacagccagggg
aagcagaagtacaccctgcccatctaccgcgccatgtggagtgggtcagagtcagcccgg
gcactggccatggagaccttctcggctacagctccccagctccatgtcaatgtccagaac
tacgtcaagaagatcctgggcttggaggtggcagagaattaa

DBGET integrated database retrieval system