KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_0496Help
Entry
NT05HA_0496       CDS       T00929                                 

Definition
(GenBank) caudovirus prohead protease
  KO
K06904  uncharacterized protein
Organism
aap  Aggregatibacter aphrophilus NJ8700
Brite
KEGG Orthology (KO) [BR:aap00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    NT05HA_0496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S78
Motif
Other DBs
NCBI-ProteinID: ACS96911
LinkDB All DBs
Position
493244..493903
Genome map
AA seq 219 aa AA seqDB search
MSIKVKDLLFKTEAVKEDGFFSGYCNVFDVPDSYDEVVRKGAFAQSIQGWNAQNKMPPVL
WNHDRNQPIGVWTLLKEDEHGLYGEGRLLVNDVARAKEIHALLLAGAIDGLSIGYRLNKW
AYNEVDDVLELLEIDLKEISIVTFPANEESRVEVVKSALAKGSLPTLPEFEKALRDLGFS
KAQATVVAGHGLRKLIQGEPENNEISNALTILKSINEGN
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattaaggttaaagacctattatttaaaaccgaagccgtcaaagaagacggcttt
ttttctggctattgtaatgtttttgatgttccagatagctacgatgaagtcgtccgaaag
ggggcattcgcacagtccattcaaggttggaatgctcaaaataaaatgccgcctgtattg
tggaatcatgatcgcaatcagcctattggtgtttggacgttgcttaaagaagatgagcat
ggtttatatggtgaagggcgtttgcttgtgaatgacgttgcaagagcaaaagagattcat
gcgcttttacttgccggcgctattgatggtttatctattgggtatcggctgaataagtgg
gcgtataacgaagtggatgacgtcttagaattgctcgaaattgacttgaaagaaatttca
attgttacattcccggctaatgaagaaagccgtgttgaggtggtgaaatccgctttggcg
aaaggtagtttgcctactttaccggaatttgaaaaagccctgagagatttagggttctca
aaagcacaagccacggttgttgctggtcatggtttgcgaaaacttattcagggcgagcct
gaaaacaacgaaatcagcaatgcactaactattttaaaatcaatcaatgagggaaattaa

DBGET integrated database retrieval system