KEGG   Acidovorax citrulli: Aave_0259Help
Entry
Aave_0259         CDS       T00451                                 

Definition
(GenBank) glutathione S-transferase, N-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aav  Acidovorax citrulli
Pathway
aav00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Aave_0259
Enzymes [BR:aav01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Aave_0259
Transporters [BR:aav02000]
 Other Transporters
  Pores ion channels [TC:1]
   Aave_0259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 Arabino_trans_C DUF1932 Tom37
Motif
Other DBs
NCBI-ProteinID: ABM30866
UniProt: A1TIS8
LinkDB All DBs
Position
complement(289443..290060)
Genome map
AA seq 205 aa AA seqDB search
MTPALTLYYAPGTCAQAVRIALCEAGAEHRLVRLDFPAGEQRSPEYLAVNPKGRVPALVT
EEGTLTETPALLAYVAQRFPQARLAPTDAHGFARMQEFHSYLASTVHVAHAHRPRAVRWA
DEPEAIAAMQRKVPQNMTECFELIEQHSLGDGPWVMGDQYTVADGYLFTVAGWLASDGVD
IARFPKVHAHSQRVAARPAVQRALT
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaccccagcccttaccctctactacgctcccggcacctgcgcgcaggcggtgcgcatc
gccctgtgcgaagccggcgcggagcaccgcctggtgcgcctcgacttcccggccggcgag
cagcgcagcccagaatacctcgcggtcaaccccaagggccgcgtgcccgccctggtcacc
gaagagggcacgctgaccgagacgcccgccctgctcgcctacgtggcgcagcgctttccg
caggcgcgcctcgcgcccaccgacgcccacggcttcgcgcgcatgcaggagttccacagc
tacctggcctccaccgtgcatgtcgcccatgcgcaccgcccccgcgcggtccgctgggcg
gacgaacccgaggccatcgccgcgatgcagcgcaaggtgccgcagaacatgaccgagtgc
ttcgagctgatcgagcagcacagcctcggcgacggcccctgggtgatgggcgaccagtac
acggtcgccgacggctacctgttcaccgtggccggctggctggccagcgacggggtggac
atcgcgcgctttcccaaggtccacgctcactctcagcgcgtggcggcgcgcccggcggta
cagcgagcactgacctga

DBGET integrated database retrieval system