KEGG   Acinetobacter baumannii AB031: IX88_13460
Entry
IX88_13460        CDS       T03376                                 

Gene name
gidA
Definition
(GenBank) tRNA uridine 5-carboxymethylaminomethyl modification protein
  KO
K03495  tRNA uridine 5-carboxymethylaminomethyl modification enzyme
Organism
abaa  Acinetobacter baumannii AB031
Brite
KEGG Orthology (KO) [BR:abaa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:abaa03016]
    IX88_13460 (gidA)
   03036 Chromosome and associated proteins [BR:abaa03036]
    IX88_13460 (gidA)
Transfer RNA biogenesis [BR:abaa03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    IX88_13460 (gidA)
 Prokaryotic type
    IX88_13460 (gidA)
Chromosome and associated proteins [BR:abaa03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    IX88_13460 (gidA)
SSDB
Motif
Pfam: GIDA GIDA_assoc FAD_oxidored Pyr_redox_2 FAD_binding_2 DAO HI0933_like AlaDh_PNT_C Pyr_redox Thi4 Pyr_redox_3 NAD_binding_9
Other DBs
NCBI-ProteinID: AIL76173
UniProt: V5VBY8
LinkDB
Position
complement(2815608..2817488)
AA seq 626 aa
MHYPKVYDVIVIGGGHAGTEAALAAARMGRQTLLLTHNIETLGQMSCNPAIGGIGKSHLV
REIDALGGAMALAADKGGIQFRILNSRKGAAVRATRAQADRVRYKAAIRETLENQANLDI
FQQAADDLIVEGDTVKGVVTQMGIRFDAKTVVLTTGTFLGGVIHVGLEKSSGGRAGDPPS
IALAQRLRELKLPVGRLKTGTPPRIDARSVDFSVMTPQPGDFPSPVMSFMGDVSMHPEQV
NCYITHTNEKTHDIIRGGLDRSPMYTGVIEGVGPRYCPSIEDKIHRFSDKDSHQVFLEPE
GLDTHELYPNGISTSLPFDVQFELVRSIRGMENAHILRPGYAIEYDYFNPQALKFTLETK
AINGLYFAGQINGTTGYEEAGAQGLLAGLNAARRAWEQEEWTPKRDQAYMGVLVDDLITL
GTKEPYRMFTSRAEYRLMLREDNADQRLTTIGRELGLVDDVRWAAYCEKMEAVERETSRL
QHLWAAPNNPMGKKFVEMTGADLSKECSAIDLLKRPNINFGQIAELTGSEVSQQVGEQIE
IAVKYEGYINRQHEDVAQLKRLEETKIPADFDYDVVSGLSREITQKLKTVRPETLAQASR
IPGVTPAAVQLVMITIRKNNMTKKTA
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgcactatcctaaagtttatgatgttatcgttatcggtggcggtcacgcaggtacggaa
gcggcgcttgctgctgcgcgtatgggacgacagactttgcttttgacccataacattgag
actttgggtcagatgagctgtaacccagcgattggtggtattggtaagtcacacttagtt
cgtgaaattgatgcgcttggcggtgcaatggctttagctgccgataaaggcggtattcaa
ttccgtattttaaactcgcgtaaaggtgctgcagtacgtgcaacgcgtgctcaggctgac
cgtgttcgctataaagctgcgattcgtgagaccttagaaaaccaagcaaatcttgatatt
ttccaacaggcggctgatgacctgattgttgaaggcgatacagttaagggtgttgtgacc
caaatgggtatccgctttgatgcaaaaactgttgtgttaactactggtacattcttgggc
ggtgttattcacgttggtttagagaaatcaagcggcggtcgtgctggtgatcctccttct
attgctcttgctcagcgtcttcgtgagttgaaattacctgtaggccgtttaaaaacaggt
acacctccacgtattgatgcacgttcagttgatttttctgttatgacaccacaaccaggc
gacttcccgtctccggtaatgtcgttcatgggtgatgtgtctatgcacccagaacaagtg
aactgctatatcacgcatactaacgaaaaaactcatgacattattcgtggtggcttagac
cgttcaccaatgtataccggtgtcattgaaggggtaggtccacgttactgtccttcaatt
gaagataagattcatcgtttctctgataaagactcgcatcaggtattcttagagccagaa
gggcttgatacacatgagctttatccaaatggtatttcgacttcattaccatttgatgtt
cagtttgaacttgtgcgctcgattcgcggtatggaaaatgcccatatcttacgtccgggt
tatgcaatcgaatatgactatttcaacccgcaagctttgaaatttaccctagaaactaaa
gcaattaacggcttgtattttgcagggcaaattaatggtactaccggttatgaagaagct
ggtgcccaaggtttacttgcaggcttgaatgctgcacgccgtgcatgggaacaagaagaa
tggacacctaaacgtgaccaagcttatatgggtgtattggttgacgacttgattacttta
ggtacgaaagagccataccgtatgttcacttcacgtgcggaatatcgtttgatgttacgt
gaagataatgccgatcaacgtttaacaactattggtcgtgagcttggtttggttgatgat
gttcgttgggcggcttattgcgaaaaaatggaagcagttgagcgcgaaacatcacgttta
caacatttatgggcggcacctaacaacccaatgggtaaaaagtttgttgaaatgacaggt
gctgacttaagtaaagaatgtagtgcgattgacttgcttaaacgtcctaatattaatttt
ggccaaattgcggaacttacaggttctgaagtatcacagcaagtcggtgagcaaattgaa
attgctgttaaatatgaaggttatatcaaccgtcagcatgaagatgtggctcaattaaaa
cgtcttgaagaaactaaaattcctgctgattttgattatgacgtcgtttcaggtttatct
cgcgaaattactcagaagttgaaaacagttcgcccggaaacattagctcaagcgagccgt
attcctggtgttaccccagctgctgttcagcttgtaatgatcacgattcgtaaaaataat
atgacgaaaaaaacggcttaa

DBGET integrated database retrieval system