KEGG   Acinetobacter baumannii D1279779: ABD1_17100
Entry
ABD1_17100        CDS       T02491                                 

Definition
(GenBank) putative oxidoreductase
Organism
abad  Acinetobacter baumannii D1279779
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like Thi4 FAD_oxidored GIDA DAO Trp_halogenase Lycopene_cycl NAD_binding_8 Pyr_redox_3
Other DBs
NCBI-ProteinID: AGH35595
LinkDB
Position
1828318..1830051
AA seq 577 aa
METKYLEFDIVVIGGGTAGPMAAIKAKQENPNLKVLLIEKANVKRSGAISMGMDGLNNAV
IPGYATPEQYTKEITIANDGVVNQTTVYAYAKHSFITIQQLDQWGIKFEKDETGEFAVKK
VHHMGAYVLPMPEGHDVKKVLYRQLKRAQVKINNRIVTTKLLKNEQGAINGVLGFDCRSG
DFYVIKTKAAILCCGAAGRLGLPASGYLMGTYENPTNAGDGYAMAYHAGAELANLECFQI
NPLIKDYNGPACAYVTGPLGGYTANSKGERFIECDYWSGQMMWEFYQELESGNGPVYLKV
DHLAEETIQTIEEILHTNERPSRGRFHEGRGTNYRQDMVEMHISEIGFCSGHSASGVWVN
EKAETSVKGLYSAGDMAAVPHNYMLGAFTYGWFAGVNAAQYVKAVEDSELNQSEIEAEKA
RIFAPLNCSEGLPPEQVEYKLRRFVNDYLQPPKTRQKMEIGLKRFEEIKQDIKRISARNP
HELMRAAEVSFIRDCAEMAARASLFREESRWGLYHYRADFPQKNNSDWFCHAHLKKDEYG
NMVSFKKPIEPYVVPINQDEAVSYDRLRIQKDVALAE
NT seq 1734 nt   +upstreamnt  +downstreamnt
atggaaactaaatatcttgagtttgatattgtggtgattggtggtggaactgctggacca
atggctgcgattaaagcaaaacaagaaaacccgaatttaaaagtcttgctcattgaaaaa
gcgaatgtaaaacgtagtggggcgatttcaatgggaatggacggtctgaataatgccgtt
attccgggatacgcaacacctgagcaatacaccaaagaaattaccattgccaatgatggg
gtagttaaccaaaccactgtatatgcatatgcaaagcatagttttataaccattcaacag
ctcgatcaatggggcattaagttcgaaaaagatgagacgggtgaatttgcagtaaaaaaa
gtacaccacatgggggcatatgttttacctatgcctgaaggtcatgacgttaaaaaagtt
ttataccgtcaattaaagcgtgctcaagtcaaaattaataatcggattgtcaccacaaag
cttttaaaaaatgagcaaggtgcaatcaatggtgtactcggttttgactgtcgtagtggt
gacttttatgtcattaaaacgaaagctgccattttatgttgtggtgccgcagggcgttta
ggtttgccagcttccggctatttaatgggtacttatgaaaacccaaccaatgcaggtgac
ggctatgcaatggcataccatgcaggtgctgagcttgccaacttagaatgcttccagatt
aatccattgattaaagactataacggtccggcttgtgcctatgtgactggtcctttagga
ggttataccgctaacagtaaaggtgaacgtttcattgaatgtgactactggagtggtcaa
atgatgtgggagttttaccaagagttggaaagtggtaatggtcctgtttatttaaaagta
gatcatctggccgaagaaaccattcaaaccatcgaagaaatcttgcataccaatgagcgc
ccaagccgtggacgttttcatgagggtcgaggaaccaattaccgtcaagatatggtggaa
atgcatatttcagaaattggtttctgtagcgggcacagtgcttctggcgtatgggtcaat
gaaaaagctgagacttcagttaaaggattatacagtgctggcgatatggcggctgtacct
cataactatatgcttggtgcatttacctatggttggtttgcgggtgtaaatgccgcccaa
tacgtgaaggcagttgaagatagtgaattaaaccaaagcgaaatagaagcagaaaaagct
cgaatatttgcgccactgaattgctcagaaggtttacctccagagcaagtggaatataag
ctgcgccgttttgtaaatgactatttgcaaccccctaaaactcgccaaaaaatggaaatt
gggctcaagcgttttgaagaaatcaaacaagatattaagcgaatttctgccagaaaccca
catgagctgatgcgtgccgctgaagtttcttttattcgagattgtgcggaaatggcagct
agagcttcactgtttagagaggaaagccgctggggactgtaccactatagagcagatttc
cctcaaaaaaataactcggattggttctgtcacgcgcatttgaaaaaagatgaatacggg
aacatggtcagtttcaaaaagccaatcgagccttatgtggttccgattaatcaagatgaa
gctgtgtcgtatgaccgtttacgcattcaaaaagatgttgctctagcagagtaa

DBGET integrated database retrieval system