KEGG   Acinetobacter baumannii AB307-0294: ABBFA_01768
Entry
ABBFA_01768       CDS       T00795                                 

Definition
(GenBank) Dihydrolipoyl dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00010  Glycolysis / Gluconeogenesis
abb00020  Citrate cycle (TCA cycle)
abb00260  Glycine, serine and threonine metabolism
abb00280  Valine, leucine and isoleucine degradation
abb00310  Lysine degradation
abb00380  Tryptophan metabolism
abb00620  Pyruvate metabolism
abb00630  Glyoxylate and dicarboxylate metabolism
abb00640  Propanoate metabolism
abb01100  Metabolic pathways
abb01110  Biosynthesis of secondary metabolites
abb01120  Microbial metabolism in diverse environments
abb01200  Carbon metabolism
Module
abb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABBFA_01768
   00020 Citrate cycle (TCA cycle)
    ABBFA_01768
   00620 Pyruvate metabolism
    ABBFA_01768
   00630 Glyoxylate and dicarboxylate metabolism
    ABBFA_01768
   00640 Propanoate metabolism
    ABBFA_01768
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABBFA_01768
   00280 Valine, leucine and isoleucine degradation
    ABBFA_01768
   00310 Lysine degradation
    ABBFA_01768
   00380 Tryptophan metabolism
    ABBFA_01768
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abb04147]
    ABBFA_01768
Enzymes [BR:abb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     ABBFA_01768
Exosome [BR:abb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ABBFA_01768
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA FAD_oxidored FAD_binding_2 NAD_binding_8 HI0933_like DAO 3HCDH_N K_oxygenase 2-Hacid_dh_C XdhC_C FAD_binding_3 Thi4 AlaDh_PNT_C ApbA ThiF Lycopene_cycl NAD_binding_7 ATPgrasp_N
Other DBs
NCBI-ProteinID: ATY44204
LinkDB
Position
complement(1924853..1926256)
AA seq 467 aa
MSEAQFDLIVIGAGPGGYVAAIRAAQLGLKTAIVEERHLGGICLNWGCIPTKALLAGAEL
ATQFKHARQFGFQVSQLDFDIQKLVQHSRQVSAQLVQGIDYLLKKNQVTVFNGRAQLTAK
EKLEVTDAQGNSQALSAPHIILATGAKARHVPQLPVDGTYVWSYKEALVPEQLPKSLLVV
GSGAIGSEFASLYQDLGCQVTLIDLAKQILPTEDAEVAQFVRKQFEQKGMKVLTDAVVQS
IQIENEQVHCVVETANDVQTLVFDRVLSAIGVQPNTTGLGLERLGVELNPQGFVAIDDYC
KTNVAGLYAIGDVAGAPCLAHKASHEAIICVEKIAGVANVHSLDRSQIPGCIFTHPQVAS
IGLTENAAKAKNLPIRIGKFSLTANGKALAIGDASGFVKTVVHAETGELLGAHMVGHEVT
EHIQGFVIAKYLEATDESLAQVIFPHPTLSEAMHESILASMQRAIHM
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcagaagctcaatttgatttaattgtgattggcgcgggaccgggtgggtatgtggct
gcaattcgtgcagcccagctcgggttaaaaaccgcaattgtagaagagcgacatttaggc
ggaatttgtctaaattggggctgtattccaaccaaagctttgcttgcaggggctgagctc
gcaacccagtttaaacatgccagacagtttggttttcaggtatcgcaactcgattttgat
attcaaaagcttgtgcaacatagccgacaagtgtcagctcaattagtacaaggcatcgat
tacttactgaaaaagaatcaggtgacggtttttaatggtcgtgctcagcttacggcaaaa
gaaaaacttgaagtgacagatgctcaaggtaatagtcaggctttgagtgcaccacatatc
attttggcaactggagctaaagctcgacatgttcctcaacttcctgtcgatggaacatat
gtctggagctataaagaagcgcttgttccagagcagttaccgaaaagtttgctggttgta
ggttcaggtgcaattggtagcgagtttgctagcctttatcaagacttgggttgtcaggtg
acattaattgatttagccaagcagattttaccaactgaagatgcggaagttgcccaattt
gtcagaaaacaatttgaacaaaaaggtatgaaagtcttaaccgatgctgtcgttcaaagt
attcaaattgaaaatgagcaagtccactgtgtggttgaaacggcaaatgatgttcaaacg
cttgtttttgatcgcgtgctttcggcaattggtgtacagccgaataccacagggctagga
ctagaacgtttaggtgtagaactcaatccacaaggttttgtggcaattgatgactattgt
aaaaccaacgtagcagggctttatgccattggtgatgttgctggagcaccttgtctcgct
cataaagcaagccatgaagccataatatgcgtcgagaaaatcgctggtgtggcaaacgtc
cattcactcgaccgtagccagatacctggttgtatttttacacatccacaagtggcgagt
attggtttaacggaaaatgcagcaaaagctaagaatctacctatacgtattggtaagttt
tctttaactgcaaatggtaaagctttagcaattggagatgcgtcaggtttcgttaaaacg
gtggtacatgcagaaacaggtgaattacttggtgcacatatggtgggtcatgaagtgacc
gaacatatccaaggatttgtcattgcgaaatatctagaagcaactgatgaaagtttagct
caagtgattttcccgcatccaacattatcagaagccatgcatgaatccattttggcttca
atgcaacgagcgattcatatgtag

DBGET integrated database retrieval system