KEGG   Acinetobacter baumannii AB307-0294: ABBFA_02593
Entry
ABBFA_02593       CDS       T00795                                 

Gene name
rubB
Definition
(GenBank) Rubredoxin-NAD(+) reductase
  KO
K05297  rubredoxin---NAD+ reductase [EC:1.18.1.1]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00071  Fatty acid degradation
Brite
KEGG Orthology (KO) [BR:abb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABBFA_02593 (rubB)
Enzymes [BR:abb01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.1  rubredoxin---NAD+ reductase
     ABBFA_02593 (rubB)
SSDB
Motif
Pfam: Pyr_redox_2 Rbx_binding Pyr_redox Pyr_redox_3 DAO Lycopene_cycl TrkA_N NAD_binding_8 3HCDH_N NAD_binding_9 DUF1188 HI0933_like NAD_binding_7 Shikimate_DH Amino_oxidase K_oxygenase ThiF ApbA Sacchrp_dh_NADP PS_pyruv_trans 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: ATY45024
LinkDB
Position
2773577..2774758
AA seq 393 aa
MHPIVIIGSGMAGYTLAREFRKLNPEQELVMICADDAVNYAKPTLSNAFAGKKAPEQIPL
GDAAKMSAQLNMRIEPFTWVKEILAERHELVLEKDGVISQQPYSKLILAVGANPIRLAIA
GDGSDDIHVVNSLIDYRSFRENLAQRKDKRVVILGAGLIGCEFANDLLHSEYDVTVIDLA
PQPLGRLLPSHIASAFQQNLEEAGVKFALGTTVEKVSKINNGEDYAVTLANGQTLVADIV
LSAIGLQPNISLAQSANIQTSRGVITNSLLETNQADIYAIGDCAEVNGTLLPYVMPIMQQ
ARALAKTLSGQQTNVHYPAMPVAVKTPAAPLTVLPAPVDVDVNWETEEFDDGMLAKAIDN
EGTLRGFVLLGATAGKQRLTLTKLVPDLIPAQA
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcatccaatcgtcattatcggatcaggcatggcgggttataccttagcacgtgaattc
cgtaagcttaacccagagcaagaacttgtgatgatttgtgcggatgatgcggtgaactat
gcaaaaccaaccttatccaatgcttttgcaggaaaaaaagccccagaacagattccatta
ggtgatgctgcaaaaatgagtgcccaactcaatatgcgtattgaaccttttacttgggtg
aaagaaattttagctgagcgtcatgaacttgttctagaaaaagacggcgttatttctcag
caaccctattcaaaattaattttagctgtcggtgctaacccgattcgccttgcaattgct
ggtgatggtagtgatgacatccatgtggtgaactcactcattgactatcgttctttccga
gaaaatctagctcagcgcaaagataaacgtgttgtgattttgggtgcaggtttaattggt
tgtgaatttgccaatgacttacttcatagcgaatatgatgtaacagtaattgatttagcg
cctcaaccattaggccgtttattaccttcacacattgcttcagcattccagcagaatctt
gaagaagcgggtgttaaatttgccttaggcacaaccgttgaaaaagtaagtaaaatcaat
aacggtgaagattacgcggttacattggcaaatggtcagactttggtcgctgatattgtg
ctttcagccattggcttacaaccgaatatttctctggctcaaagcgcaaatattcaaacc
agccgtggtgtgattaccaatagtttacttgaaaccaatcaagcagatatttatgcgatt
ggtgactgtgcggaagttaacggtaccctgcttccatatgtaatgccaattatgcaacaa
gcccgcgctctagcaaaaacattaagcggtcaacaaacaaatgtacattaccctgctatg
ccagttgcggtaaaaactccggctgcaccgcttacagttttaccggcacccgttgatgta
gatgtaaattgggaaactgaagaattcgacgatggtatgcttgccaaagcaattgacaat
gaaggaacattgcgtggtttcgtattgttaggtgcaacagcaggcaagcaacgtttaact
ttaactaagcttgttccagatcttattcctgcccaagcataa

DBGET integrated database retrieval system