KEGG   Acinetobacter baumannii AB307-0294: ABBFA_02717
Entry
ABBFA_02717       CDS       T00795                                 

Definition
(GenBank) Glucosaminate ammonia-lyase
Organism
abb  Acinetobacter baumannii AB307-0294
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 FAD_oxidored FAD_binding_2 GIDA HI0933_like K_oxygenase NAD_binding_8 NAD_binding_7 Thi4 FMO-like Staph_opine_DH
Other DBs
NCBI-ProteinID: ATY45147
LinkDB
Position
2912092..2913039
AA seq 315 aa
MSARHSRLIILGSGPAGYSAAVYAARANLKPTLIAGLQLGGQLTTTTEVDNWPGDPEGLT
GPVLMDRMQAHAERFGTELVYDHINEVDLNVRPFVLKGDMDEYTCDALIIATGATAQYLG
LESEQKFMGQGVSACATCDGFFYKNQNVMVVGGGNTAVEEALYLSNIAEHVTLVHRRDSL
RSEKILQDHLFAKEKEGKISIVWNHEVEEVLGDNTGVTGVRLKSTKDDSKQEVQVQGLFI
AIGHKPNTSMFEGQLNLRDGYIQVQSGTSGNATATSVAGVFAAGDVADSIYRQAITSAGS
GCMAALDAEKYLDNL
NT seq 948 nt   +upstreamnt  +downstreamnt
atgagtgctcgtcattctcggttaattattctcggttctggccctgcgggttatagtgca
gctgtctatgcagcacgtgcaaatcttaaaccaacacttattgcaggtttacagcttggc
ggccaacttacaacaacaaccgaagttgacaactggccgggcgatcctgaaggtttgact
ggtcctgtcctaatggaccgtatgcaagcacatgctgaacgctttggtaccgaacttgtc
tatgatcatattaatgaagtggacttaaatgtacgtccttttgttcttaaaggtgatatg
gatgagtacacttgtgatgctttaattattgcaaccggtgcgacagctcaatatcttggc
ttagagtctgaacaaaaatttatgggtcaaggcgtgagtgcatgtgcaacatgtgatggc
ttcttctacaagaaccaaaatgtgatggttgttggtggtggtaatactgctgttgaagaa
gcactttatttatcaaatattgctgaacatgtgacacttgtacaccgccgtgattcttta
cgctctgagaagattttgcaagatcacttatttgctaaagaaaaagaaggcaaaatcagt
atcgtttggaaccatgaggttgaagaagttcttggtgacaatactggcgtaacaggtgtt
cgcttaaaatctacgaaagatgacagcaaacaagaagtacaagttcaaggcttattcatt
gcaattggccataaaccaaatacctctatgtttgaaggtcagctaaacttacgtgatggc
tatatccaagtacaaagtggtacttcaggtaacgcaacagcgacttctgtagcaggcgtt
tttgctgctggtgatgttgctgatagtatctatcgtcaagcgattacttcggcgggttca
ggctgtatggctgcactagatgccgaaaaatatctagataacctttaa

DBGET integrated database retrieval system