KEGG   Aeromonas caviae: VI35_07260
Entry
VI35_07260        CDS       T05190                                 

Definition
(GenBank) peptidase M48
  KO
K01423  beta-barrel assembly-enhancing protease [EC:3.4.-.-]
Organism
acav  Aeromonas caviae
Brite
KEGG Orthology (KO) [BR:acav00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:acav01002]
    VI35_07260
Enzymes [BR:acav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     VI35_07260
Peptidases and inhibitors [BR:acav01002]
 Metallo peptidases
  Family M48: Ste24 endopeptidase family
   VI35_07260
SSDB
Motif
Pfam: Peptidase_M48 TPR_19 TPR_16 TPR_6 TPR_14 ANAPC3 BTAD DUF4157 DUF2201_N DUF2268
Other DBs
NCBI-ProteinID: ATP92311
UniProt: A0A2K0LUN9
LinkDB
Position
1509826..1511229
AA seq 467 aa
MGATFHAQGSNQLPDIGTAGVAALPIEQEVRYGNAFMRFARAGLPIIDDPVLNEYIDDLG
QRLLTNADGVRFPFTFFLINDPSINAAAFLGGRVKVHTGLFLYAESESELASVLAHEITH
VTQRHIARYMEAQASSSAMTLAGLVGSIALAVINPTAGIAALQTTLGLSMQSAINYTRDN
EYEADRIGMKTLYDAGFDPMGMANFFQKLAAEYRYASKPPEMLLTHPLPETRISEARARA
GSYGARALPPSLDFWLAKVRIQVRYGTETPQALLTYFDSRLQKGDYPLKDAAIYGKALAL
LQLKRTDEADTLMQELATRHPEDLFVVDALTDIDLAKGRSAQAIARLERFRTRMPDNEVV
VVNLGNAYLEGGNYKKSIAILDPYAREHDENSLAWSLLSDAYRKAGRMTDLHMARAETLS
LRGDYQAAIDELIVARGTTSDKLTLARIEARITQLERAKKDLDSLKG
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgggggcgaccttccacgcccaggggagcaaccagttgcccgacatcggtaccgccggg
gtcgccgcactgcccatcgagcaggaggtgcgctacggcaacgccttcatgcgttttgcc
cgggcgggcctgcccatcatcgatgaccccgtgctcaacgaatacatcgacgatctgggc
cagcggctgctgaccaatgccgacggggtgcgcttcccgttcaccttcttcctcatcaat
gatcccagcatcaacgcggcggccttcctaggtggccgggtcaaggtgcacaccggcctc
ttcctctacgccgagagcgagagcgagctggcctcggtactggcccacgaaatcacccat
gtgacccagcgtcacatcgcccgttacatggaggcacaggcgagcagctccgccatgacc
ctggccggcctggtgggctccattgcactcgcggtgatcaaccccaccgccggcatcgcg
gccttgcagaccacgcttggtttgtcgatgcagtcggccatcaactacacccgggacaac
gaatacgaggcggatcgcatcggcatgaagacgctgtatgacgccgggttcgatcccatg
ggcatggccaacttcttccagaagctggcggcggagtaccgctatgccagcaagccgccg
gagatgctgctgactcaccccctgccggagacccggatcagcgaagcccgtgcccgggcc
gggagctatggcgcgcgcgccctgccgccgagcctggacttctggctggccaaggtacgc
atccaggtgcgctatggcaccgagacgccccaggcgctgctcacctacttcgacagccgc
ctgcagaagggggattaccccctcaaggatgccgccatctatggcaaggcgctggccctg
ttgcagctcaagcgcaccgacgaggccgataccctgatgcaggagctggcgacccgtcac
ccggaggatctcttcgtggtggatgccctgaccgacatcgatctcgccaagggccgcagc
gcccaggccatcgccagactggagcgcttccgtacccggatgccggacaacgaggtggtg
gtggtgaacctcggcaacgcctatctggaggggggcaactacaagaaatccatcgccatc
ctggacccttatgcccgggagcacgacgagaacagcctggcctggagcctgctgtcggac
gcctaccgcaaggcgggcagaatgacggacctgcacatggcgcgggctgagaccctctcc
ctgcgcggggactaccaggcggccatcgacgaactgatcgtggcccggggcaccaccagc
gacaagctgaccctggcccgcatcgaggcgcgcatcacccagctggagcgggccaagaag
gatctggacagcctcaagggctga

DBGET integrated database retrieval system