KEGG   Acinetobacter baumannii ATCC 17978: A1S_1200Help
Entry
A1S_1200          CDS       T00486                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
acb  Acinetobacter baumannii ATCC 17978
Brite
KEGG Orthology (KO) [BR:acb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A1S_1200
Enzymes [BR:acb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A1S_1200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 HI0933_like K_oxygenase DAO AlaDh_PNT_C FMO-like
Motif
Other DBs
NCBI-ProteinID: ABO11630
LinkDB All DBs
Position
complement(1405278..1406099)
Genome map
AA seq 273 aa AA seqDB search
MDTMDIENFTSVQKTQGPKFAAEMEAHVREYDVDIMNLQRVSKITGADQTANGLVEVELE
NGAKLESKTVILSTGARWREMNVPGEAEYRTRGVAYCPHCDGPLFKGKRVAVIGGGNSGV
EAAIDLAGIVEHVTLVEFDTKLRADQVLQNKLNSLPNTTVIMNALSTEVLGDGSQVTGLK
YKDRSTDEEHVVELAGIFVQIGLLPNTDFLKDSEVELTNRGEIIVNDRNETNVKGVFAAG
DCTTVPYKQIIIATGEGAKASLSAFDYIIRSGQ
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggacaccatggacattgaaaacttcacttctgtgcaaaagacccaaggtcctaagttt
gctgctgaaatggaagcacatgttcgtgaatacgatgtggatatcatgaacctgcaacgt
gtcagcaaaatcacgggtgcagaccaaacagcaaatggcttggttgaagttgaacttgaa
aacggtgcaaaacttgaatcgaaaactgtgatcctttcaacaggggcacgttggagagaa
atgaatgtaccgggtgaagctgaataccgtacccgtggtgtagcgtactgtccacactgt
gatggtccattgttcaaaggcaaacgtgttgccgtgattggtggcggtaactcaggtgtt
gaagcggcgattgaccttgcaggtattgttgagcatgtaactctggttgagtttgacact
aaacttcgtgctgaccaagtcttgcaaaacaagttaaacagcttgccaaacaccactgtg
attatgaatgcattaagcacagaagtattgggtgacggttcacaagtaacgggtcttaaa
tataaagaccgttcgactgatgaagagcatgtggtagagcttgcagggatctttgtacag
attggtttacttccaaacactgacttcttaaaagacagtgaggttgagttaaccaaccgt
ggcgagatcattgtcaatgaccgcaacgaaaccaatgtaaaaggtgtatttgctgcaggt
gactgtaccactgtaccttacaagcagatcattattgctacaggtgaaggcgctaaagca
tcactctctgcgtttgattacattattcgttctgggcaataa

DBGET integrated database retrieval system