Acidothermus cellulolyticus: Acel_1772 Help Entry Acel_1772         CDS       T00426                                  Name (GenBank) Glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism ace  Acidothermus cellulolyticus Brite KEGG Orthology (KO) [BR:ace00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     Acel_1772 Enzymes [BR:ace01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      Acel_1772 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 GST_N_3 Glrx-like Thioredoxin IU_nuc_hydro Thioredoxin_7 Motif Other DBs NCBI-ProteinID:  ABK53544 UniProt:  A0LVT4 LinkDB All DBs Position 2009133..2009402 Genome browser AA seq 89 aa AA seqDB search MPDGTTVTIFTTPWCGYCRRLKRELDEQGIPYQEVNIEADPEAADLVARVNGGNQTVPTV LFPDGRTLTNPPASAVIARLADLQATPQR NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgcccgacgggacgaccgtgacaatcttcaccaccccgtggtgcggctactgccgccgg ctcaagcgagagctcgacgaacagggcatcccgtaccaggaggtgaacatcgaggccgac ccggaggctgccgacctcgttgcgcgggtcaacgggggaaaccagaccgtgcccacggtg ctcttccctgacgggcgcacgttgaccaaccccccggcgtccgccgtcatcgcccggctc gccgacctgcaggccacaccccagcgatag

DBGET integrated database retrieval system