KEGG   Atta cephalotes (leaf cutting ant): 105617857Help
Entry
105617857         CDS       T04923                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: tyrosine-protein kinase hopscotch-like
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:acep00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105617857
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acep01001]
    105617857
Enzymes [BR:acep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     105617857
Protein kinases [BR:acep01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   105617857
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase FERM_F1 RIO1 Jak1_Phl FERM_F2 Kinase-like APH Pkinase_fungal FERM_M DUF2400
Motif
Other DBs
NCBI-GeneID: 105617857
NCBI-ProteinID: XP_012054793
UniProt: A0A158NB85
LinkDB All DBs
Position
Unknown
AA seq 949 aa AA seqDB search
MDDDSRLSHYVYIYMANRDKPLKFAFTIGETIEYLCIKICHNFNISPLARHLFALQSYSS
KLWFPCGHILEEDSEKYRFNFRLRFKPSSMDRLREIDLNAYNYYFEQVRKDVLDNKVPDI
VYEKHKHELIGLGVSDMYRVMLEEELPREIVESEYKKYIPKECIKRHAFFIRKPIHNALT
KLSGYDAAYVKEQYLKQFERMAPNYPYEEYTALMDKDVPNLRAKVLLRVTIEQVKYCEID
IGTWKTICRIEDISTLSIGKNNTVLIGRRTGIPLCVQFDTKAILLSFVSALDGYYRLSVK
WNFNLCSGDLSIITPSLERLQKLRCHGPVGKDFSYTKLKEKCANEPGSYILRESETEYCV
YYIDVYNKDGTISSQEXVEAKPEFVMTEENHVIHGNIRCRNILVHSHTDNSFIVKLGDPG
LFTYTEDDIYWIPPECYLDFASAKYSLQADIWALATTIWEIFSRGASPPKYHKTHTVKMY
YKCGNRLPPPKDCPNEIYKLMLECWGKNNSIARKQPQAIMRDINQILYEVYNARRTHTYA
TICPKFFRDADGNNDENSSIYTEESKSNSESQTSLVTDYTNITWNDHTTEQLISYQNQDS
NIDELSFYLRWLNSELYKMPFAGNGNDCEDSSGKTNKSKSNDKACNSKDCSQWQRTYEIN
ENLDVILQGRIGEGFYGEVYKGTLRRRNDKEVDSEQDVAVKKLKTQEDSENVLDFEREIK
IMERLNHPNIVKILCSVDRILVMEFIQYGSLLSYLSSHRYSLAYKTLLGFALDIVAGMEY
LGSMNIVHRDLAARNILVANEDRVKISDFGLAQVIAASDYYVFKTLRNIPIKWYAPESLR
HNKFSTRSDVWSFGVTMYEVFSYGVDPQLSVRVAEKEILMTTITDLSNALERGHRLPCPN
NCPQEIHRKLMLSCWQLNSHERPIFATLREDIEQLLFSSIETFEANGTS
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgactcgcgactgtcacattatgtatacatttatatggccaacagggataaa
ccattgaaatttgcatttactattggtgaaaccatcgagtatttgtgtataaagatatgc
cataacttcaatataagtcctttagcaagacatctgtttgcactgcaaagttattcttca
aaactatggttcccttgtggtcacatactagaagaagactcggagaaatacagattcaat
tttcgcctgagattcaagccatctagtatggacaggctgagagaaatagatttaaatgca
tataattattattttgaacaagttcgtaaagatgtattggataacaaggtacctgacatt
gtttatgaaaaacataaacatgaattaattggcttaggagttagtgatatgtatagagta
atgcttgaagaagaactcccacgtgaaattgtagaatcagaatataaaaaatatatacct
aaggaatgcataaaaagacatgccttttttattagaaaacctattcacaatgcacttaca
aaattatctggatatgatgctgcatacgtcaaggagcagtatttgaaacagtttgaacgc
atggccccaaattatccatatgaagaatacacagcattaatggataaagatgttcctaat
ctaagagctaaagtcttacttagggttaccatagagcaagtaaaatactgtgagattgac
attggtacatggaaaacgatttgtaggatagaggatatatccactctctctataggaaag
aataatactgtgttaattgggaggagaactggcataccattgtgtgtacaatttgataca
aaagcgattttattatcatttgtatccgcattggacggatattaccgcttatctgttaag
tggaattttaatctgtgtagtggtgatcttagtattattacgccttccttagaaagatta
caaaaattaaggtgccatggaccagttggaaaggatttctcgtatacgaagcttaaagaa
aaatgtgccaacgagcctggaagttatatactgcgcgaaagtgaaaccgagtattgtgtt
tattacatcgacgtttataacaaagacggaactatatcttcgcaagaantagtagaggct
aaacctgaatttgtaatgacagaggagaatcatgtaattcatggaaatataagatgccgg
aacattctcgtacattcacacacagataacagcttcattgtcaagttgggtgatcctggt
ctcttcacttatactgaggacgacatatattggataccacccgaatgttacttggatttt
gcgtcagcaaaatatagtcttcaagcggatatatgggcactggcgacgactatttgggag
atattttccagaggggcttctccacccaaatatcataaaactcatactgttaaaatgtat
tataaatgtggaaaccgattgcctcctcctaaagattgtccaaacgaaatctataaatta
atgttggaatgctggggcaaaaataattccatagcaaggaaacaacctcaggctattatg
cgagatatcaatcagattctctatgaagtatataacgctcgtagaactcatacttacgct
actatatgtcccaagttttttcgagatgccgatggaaacaatgacgagaatagcagtatt
tatacagaagaaagcaaatcaaatagtgaatcacaaacgagtttggtcactgattatact
aatattacttggaacgatcatactacagagcaattgatcagctatcagaatcaagacagc
aacatagatgaattgtcattttatttgcgttggttgaatagcgagttgtacaagatgcca
tttgcgggtaatggcaatgattgcgaagatagctcaggcaaaactaataaaagtaaaagt
aatgacaaggcttgcaacagtaaagattgttctcaatggcagcgtacttacgagataaat
gaaaatttggatgtgatcttgcaaggacgtataggcgaaggcttttatggtgaagtatat
aagggtacgctcagaagacgtaatgataaggaagttgattcggagcaggatgtagccgtc
aaaaaactcaagacgcaggaggactcagaaaatgtgcttgacttcgaaagagaaattaaa
attatggagagactcaatcatccaaacattgtaaaaattttgtgctcagtggaccgaatt
ctggtgatggaatttattcaatatggttcgttgttgagttatctaagttcgcatcggtac
agtcttgcatataaaacactattaggcttcgctctagacatcgttgcgggtatggagtat
ctcggtagtatgaacattgttcaccgagatttagcagcgagaaatatcctagtagcgaac
gaagatcgagtgaaaatcagtgacttcggtcttgcgcaagtgatagctgcgagtgattat
tatgtatttaaaactcttcgtaatattccaattaaatggtatgcacctgagagcttgagg
cataacaaattttcaacgcgttcggatgtgtggtcatttggtgtgacaatgtacgaagtt
tttagttatggtgtcgatccacaactgtcagtcagagtggctgaaaaagaaattttaatg
acgactataacggacttatcgaacgcattggaacgtggccaccgtcttccttgtccgaat
aactgtccacaggaaattcatagaaaattgatgttatcatgctggcaattgaatagtcat
gaaagaccgatttttgctactctacgcgaagatatcgagcaactactttttagttctatt
gagactttcgaagcaaatggaacatcctaa

DBGET integrated database retrieval system