Acidianus sp. HS-5: HS5_07370 Help Entry HS5_07370         CDS       T07980                                  Name (GenBank) ferredoxin   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism acih  Acidianus sp. HS-5 Pathway acih00010   Glycolysis / Gluconeogenesis acih00020   Citrate cycle (TCA cycle) acih00620   Pyruvate metabolism acih00633   Nitrotoluene degradation acih00640   Propanoate metabolism acih00650   Butanoate metabolism acih00680   Methane metabolism acih00720   Carbon fixation pathways in prokaryotes acih01100   Metabolic pathways acih01110   Biosynthesis of secondary metabolites acih01120   Microbial metabolism in diverse environments acih01200   Carbon metabolism acih01210   2-Oxocarboxylic acid metabolism Module acih_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:acih00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     HS5_07370    00020 Citrate cycle (TCA cycle)     HS5_07370    00620 Pyruvate metabolism     HS5_07370    00640 Propanoate metabolism     HS5_07370    00650 Butanoate metabolism     HS5_07370   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     HS5_07370    00680 Methane metabolism     HS5_07370   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     HS5_07370 Enzymes [BR:acih01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      HS5_07370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_10 Fer4_2 Fer4_21 Fer4_7 Fer4_9 Fer4_16 Fer4_4 Fer4_15 Fer4_17 Fer4_8 Fer4_3 Fer4_13 Fer4_18 Fer4_22 Motif Other DBs NCBI-ProteinID:  BDC17847 LinkDB All DBs Position complement(690153..690413) Genome browser AA seq 86 aa AA seqDB search MINYPIPLGRPSIGSSGLTGHWRLMRPEIDYSKCTKCRLCVIYCPENTIDLLEGFDVRID YDYCKGCGVCAQICPQKAITMVQEVK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgattaactatcccatacctttaggaagacccagtataggttcttccgggcttaccggg cattggaggttaatgaggcccgaaattgattactccaagtgcacaaagtgtaggctttgc gtaatttattgtccggaaaataccatagatttactggaaggctttgacgtcaggatagac tatgattactgtaaaggttgcggagtatgtgctcagatatgccctcaaaaagcaataaca atggttcaagaggtgaagtga

DBGET integrated database retrieval system