KEGG   Acidovorax carolinensis P3: CBP35_05460Help
Entry
CBP35_05460       CDS       T04998                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
acis  Acidovorax carolinensis P3
Brite
KEGG Orthology (KO) [BR:acis00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CBP35_05460
Enzymes [BR:acis01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CBP35_05460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored DAO Glutaredoxin FAD_binding_3 K_oxygenase AlaDh_PNT_C FMO-like Thi4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ART54621
UniProt: A0A240UDZ0
LinkDB All DBs
Position
1172488..1174056
Genome map
AA seq 522 aa AA seqDB search
MLDEQLKTQLSAYLERVQQPFELVASLDDSDTAREMLDLLQTIQSLRSDKITLRTDGNDA
RKPSFSLQRVGSTSQLRFAGLPLGHEFTSLVLALLWTGGHPPKAEQDVLDQIDALEGDFN
FEVYMSLSCHNCPDVVQALSLMAIRNPRIKTTVIEGGAFQEEVNRREVMAVPMVFLNGEV
FGSGRMLLEEIVAKLDTGAAAKEAAKLSAKEAFDVLIIGGGPAGAAAAVYAARKGIRTGV
AAERFGGQVNDTLGIENYISVLETDGPKFAAALEAHTRAYDVDIMNLQRAEALIPATEPG
GLIEVKLANGGSLRSKSVILSTGARWRNVNVPGEAEYKNKGVAYCPHCDGPLFKGKRVSV
IGGGNSGVEAAIDLAGVVQHVTLVEFADQLKADAVLVSKLKSLPNVTIHTNAQTTEITGA
DGKVNGMKFKDRASGQEHLVPLEGVFVQIGLVPNTDWLKGTVELSRFGEIEIDAKGHTNV
PGVFAAGDCTTVPYKQIVIAAGAGATAALSAFDHLIRSGVTA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgaacaactcaagacccaactttcggcatacctggaacgcgtgcagcagccg
ttcgagctggtggcatccctggacgacagcgacaccgcccgcgaaatgctggacctgttg
caaaccatccagtcgctgcgcagcgacaagatcaccctgcgcaccgatggcaacgacgcg
cgcaagccctcgttctcgctgcagcgcgtgggtagcaccagccagctgcgctttgccggc
ctgccgctgggccatgagttcacatcgctggtgctggcactgctctggacgggcggccat
ccgcccaaggccgagcaggatgttctggaccagattgacgcgctcgaaggcgatttcaac
ttcgaggtctacatgagcctgagctgccacaactgccccgacgtggtgcaggcgctgagc
ctcatggccatccgcaacccgcgcatcaagaccacggtgatcgaaggcggcgccttccag
gaagaagtgaaccgccgcgaagtcatggccgtgcccatggtgttcctgaacggcgaagtg
ttcggctcgggccgcatgctgctcgaagaaatcgtcgccaagctcgataccggcgccgcc
gccaaagaggccgccaagctcagcgccaaagaagcctttgacgtgctcatcatcggtggt
ggccccgcaggcgctgccgctgccgtgtatgccgcccgcaaaggcatccgcaccggcgtg
gccgccgagcgctttggcggacaggtcaatgacaccctgggcatcgaaaattacatctcg
gtgctggagaccgacggccccaagtttgccgccgccctcgaagcccacacccgcgcctac
gacgtggacatcatgaacctgcagcgcgccgaagcgctgattcccgccaccgaacccggc
ggcctgatcgaggtgaagctggccaacggcggctcgctcaggtccaagagcgtgattctg
tccaccggcgcgcgctggcgcaatgtgaatgtgcccggcgaagccgagtacaagaacaaa
ggcgtggcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtgtcggtc
atcggtggcggcaactcgggtgtcgaggccgctattgacctggccggtgtggtgcagcat
gtcacgctggtggagtttgccgaccagctcaaggccgacgccgtgctggtgagcaagctc
aagagcctgcccaatgtcaccatccataccaacgcgcagaccaccgaaatcaccggtgcc
gacggcaaggtgaacggcatgaagttcaaggaccgcgcctcgggccaggagcacctggtg
cccctggaaggcgtgttcgtgcagatcggcctggtgcccaacaccgactggctcaagggc
acggtcgagttgagcaggtttggcgagatcgagatcgacgccaagggccacaccaacgtg
ccgggcgtgtttgctgccggcgactgcaccaccgtgccctacaagcagatcgtgattgcc
gccggcgccggtgccacggccgcgttgagcgcgttcgaccatttgatccgcagcggcgta
acggcctga

DBGET integrated database retrieval system