KEGG   Acidovorax sp. KKS102: C380_15950
Entry
C380_15950        CDS       T02290                                 

Gene name
bphD
Definition
(GenBank) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoic acid hydrolase BphD
  KO
K10222  2,6-dioxo-6-phenylhexa-3-enoate hydrolase [EC:3.7.1.8]
Organism
ack  Acidovorax sp. KKS102
Pathway
ack00621  Dioxin degradation
ack01100  Metabolic pathways
ack01120  Microbial metabolism in diverse environments
ack01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ack00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    C380_15950 (bphD)
Enzymes [BR:ack01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.8  2,6-dioxo-6-phenylhexa-3-enoate hydrolase
     C380_15950 (bphD)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Esterase Peptidase_S9 DUF915
Other DBs
NCBI-ProteinID: AFU46885
UniProt: E7FJB7
LinkDB
Position
3472466..3473326
AA seq 286 aa
MSELNESSTSKFVTINEKGLSNFRIHLNDAGQGEAVIMLHGGGPGAGGWSNYYRNIGPFV
EAGYRVLLPDAPGFNKSDTVVMDEQRGLVNARSVKGMMDVLGIEKAHLVGNSMGGAGALN
FALEYPERTGKLILMGPGGLGNSLFTAMPMEGIKLLFKLYAEPSLETLKQMLNVFLFDQS
VITDELLQGRWANIQRNPEHLKNFILSAQKVPLSAWDVSARLGEIKAKTLVTWGRDDRFV
PLDHGLKLIANMQDAQLHVFPRCGHWAQWEHADAFNRLTLDFLANG
NT seq 861 nt   +upstreamnt  +downstreamnt
atgtcagaactcaacgaaagctcgacgagcaaatttgtcaccatcaacgagaagggcctc
tccaacttccgcattcacctcaacgatgcaggccagggcgaagcggtcatcatgctgcac
ggcggaggcccgggcgcggggggctggagcaactattaccgcaacatcggccccttcgtc
gaggctggctaccgcgtgctcctcccggacgcaccgggcttcaacaagtccgacaccgtc
gtgatggacgaacagcgcggcctggtcaatgcgcgctcggtcaagggcatgatggacgtg
ctcggcatcgaaaaagcgcacctcgtgggcaactcgatgggcggtgcaggcgcgctgaac
tttgctctggaataccctgagcgcaccggcaaactcatcctcatggggccgggcggattg
ggcaacagcttgttcaccgccatgcccatggaaggcatcaagctgctgttcaagctttac
gccgagccctcgctcgaaacgctcaagcagatgctcaacgtattcctgttcgaccagagc
gtgatcaccgacgagctgctgcaaggacgctgggccaacatccagcgcaaccccgagcac
ctgaagaacttcatcctgagcgcacaaaaagtgccgctctcggcttgggacgtgtcggcg
cgtctgggcgagatcaaggccaagaccctggtcacctgggggcgcgacgaccgcttcgtg
ccgctggaccatggcctcaagctgatcgcgaacatgcaggatgcgcagctgcacgtcttc
ccgcgctgcggccattgggcgcagtgggagcacgcggacgccttcaaccggctgacgctg
gacttcctggccaacggctga

DBGET integrated database retrieval system