KEGG   Acidovorax sp. RAC01: BSY15_306
Entry
BSY15_306         CDS       T04481                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K07534  cyclohex-1-ene-1-carboxyl-CoA hydratase [EC:4.2.1.-]
Organism
acra  Acidovorax sp. RAC01
Pathway
acra00362  Benzoate degradation
acra01100  Metabolic pathways
acra01120  Microbial metabolism in diverse environments
acra01220  Degradation of aromatic compounds
Module
acra_M00540  Benzoate degradation, cyclohexanecarboxylic acid =>pimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:acra00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSY15_306
Enzymes [BR:acra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     BSY15_306
SSDB
Motif
Pfam: ECH_1 ECH_2 DUF4351 Peptidase_S49
Other DBs
NCBI-ProteinID: AOG22902
UniProt: A0A1B3PJF0
LinkDB
Position
325680..326456
AA seq 258 aa
MNEALILTERQGRVGVITLQRPQQLNALNDALMDQLGAALLAFDADDDIGAIVITGSARA
FAAGADIAAMADWSFMDVYRGAFITRNWETIRQVRKPVLAAVAGFAMGGGCELALACDII
VAAESARFALPEIKLAMLPGAGGTQRLPRAIGKAKAMDMCLSARTLDAHEADRYGLVSRV
VPDAELLARTLALATQIAGFSLPALMAIKASVNRAWESPLTEGILFERHALYERFASADA
HEGMHAFLDKRTPVFEHR
NT seq 777 nt   +upstreamnt  +downstreamnt
atgaacgaagcactgatcctgacggaacgacaaggccgggtgggcgtaatcacgctccag
cggccccagcagctcaatgcactcaacgacgccctgatggaccaactgggggctgcgctg
ctggcctttgacgcagacgatgacataggggccatcgtcatcacgggcagcgccagggcg
tttgcggcgggggccgacatcgccgccatggccgactggtcgttcatggatgtctatcgc
ggcgctttcatcacgcgcaactgggaaaccatacgccaggtgcgcaaaccggtgctggcc
gccgtggcaggctttgccatgggtggtggctgcgagctggccctggcctgtgacatcatc
gtggcggctgaatcagcccgctttgccctgcctgaaatcaagctcgccatgctgcccggc
gcaggcggcacgcagcgcctgccgcgcgccatcggcaaggccaaggcgatggatatgtgc
ctgtcggcccgcacgctcgatgcgcacgaggccgaccgctatgggctggtgtcgcgcgtg
gtgcccgatgccgaactgctggcccgcacactggcactggccacgcagatcgcgggtttt
tcgctgcccgcgctcatggccatcaaggcatcggtcaaccgtgcatgggaaagcccgctg
accgaaggcatcctgttcgagcgccacgcactgtacgaacgctttgccagcgccgacgcg
cacgagggcatgcatgcgtttctggacaagcgcaccccggtgttcgagcaccgctga

DBGET integrated database retrieval system