KEGG   Arthrobacter crystallopoietes: AC20117_22570Help
Entry
AC20117_22570     CDS       T05322                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
acry  Arthrobacter crystallopoietes
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AUI53739
UniProt: A0A1H1HZZ8
LinkDB All DBs
Position
pLDW-10:101268..102755
Genome map
AA seq 495 aa AA seqDB search
MTEQLRKAPIANSGKFYIGGKWVDPSSTATIDVIEAATEELYFTVAEARAADIARAVEAA
RRAFDEGPWPRMSPGQRAEYLRAIAQAVAERTDDLVQLWPRESGILANLVPTVMKEVPAA
FSFYADLADRFPFEQAAPTSSGEGFGMLVGEPVGVVGAIIPWNTPMPLIAYKLAPALLAG
CTVIIKASPEAPGAAYVMAEIAEQVGLPDGVVNVLAADREASETLVRDHRVDKISFTGST
AVGKTIAGIMGDRIGRYSLELGGKSAAVILEDMDVAEAAENLASAGCFVSGQICASLSRV
VIPRHRHDDMVEALADRFSRVKIGNPFDAGVGMGPLATQRQRERVEGYVAIGRAEGATLA
TGGRRPKDLDRGWFVEPTVFGNVDNSSKIAQEEIFGPVMSVIPAADEEDAIRIANDTVFG
LNAAVFTHDADRAREVGRRLRAGTVGQNGNRADFGIGFGGFKQSGIGREGGVAGLLPYLE
NKTMVFDEKPRHAPA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcaattgcgtaaagcccccattgcgaattcggggaagttctatattggcgga
aaatgggtcgacccgtcgtcaacggccacgatcgacgtgatcgaagcagcaacggaggaa
ctctacttcaccgtcgccgaagccagagcagccgatatcgcacgggctgtggaggcagcc
cgtcgggcgttcgacgagggtccatggccacggatgtcgccgggccagcgcgccgagtac
ctgcgagcgatcgctcaggctgtggccgagcggaccgacgatctggtccaattgtggccc
cgtgagtcggggatcctcgccaacctggtgccgaccgtcatgaaggaagtcccggcagcc
ttttccttttatgcggatctcgctgatcggttccccttcgaacaggcagcgccgaccagc
tcgggcgaaggcttcggcatgctcgtcggggagcccgtgggagttgtcggagcgatcatc
ccctggaatacgccgatgccgctaatcgcgtacaagctcgccccggcgctcctcgccgga
tgcactgtgatcatcaaggcgtcgcccgaggctcccggtgctgcgtacgtgatggcggag
atcgcggagcaggtcgggctgcccgacggtgtcgtcaatgtgctcgccgccgatcgagag
gcgtccgagacgctcgtgcgcgatcatcgcgtggacaagatctccttcaccggttcaacg
gcggtcggaaaaaccatcgcagggattatgggcgaccggatcggccgatactcgcttgag
ctgggaggcaagtccgcagctgtcatcctcgaggacatggacgtcgccgaggcggctgaa
aacctggccagcgccggatgtttcgtctccgggcagatctgtgcatcgctgtcccgtgtc
gtcataccgcgccatcggcacgacgacatggtcgaggcgcttgcggaccgcttctcccga
gtcaagatcgggaatccgttcgatgccggcgtcgggatggggccgttggccacccagcga
cagcgtgagcgggtcgaaggctacgtcgctataggtagagccgaaggtgcaacactcgct
accggaggcaggcggcccaaagacctcgaccggggctggttcgtcgagccgactgtgttc
gggaacgtcgacaactcctcgaaaatcgctcaggaggagatcttcgggcccgtgatgtcg
gtcatcccggcggcggacgaggaggatgcgatccggatcgcaaatgatacggtgttcggg
ctcaacgcggctgttttcactcacgatgccgaccgggcgcgagaggtgggcaggcgtctg
cgcgccgggacggtcggtcagaacggcaaccgggcggacttcgggatcgggttcggtgga
ttcaaacaatccggcatcggccgtgagggcggcgtcgcaggtctgctcccgtacctggag
aacaagacaatggtcttcgacgagaagccccgtcatgcacctgcctaa

DBGET integrated database retrieval system