KEGG   Anolis carolinensis (green anole): 100553927
Entry
100553927         CDS       T01608                                 

Gene name
akt3
Definition
(RefSeq) AKT serine/threonine kinase 3
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04210  Apoptosis
acs04218  Cellular senescence
acs04261  Adrenergic signaling in cardiomyocytes
acs04370  VEGF signaling pathway
acs04371  Apelin signaling pathway
acs04510  Focal adhesion
acs04620  Toll-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04910  Insulin signaling pathway
acs04914  Progesterone-mediated oocyte maturation
acs04920  Adipocytokine signaling pathway
acs05132  Salmonella infection
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100553927 (akt3)
   04012 ErbB signaling pathway
    100553927 (akt3)
   04370 VEGF signaling pathway
    100553927 (akt3)
   04371 Apelin signaling pathway
    100553927 (akt3)
   04068 FoxO signaling pathway
    100553927 (akt3)
   04150 mTOR signaling pathway
    100553927 (akt3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100553927 (akt3)
  09143 Cell growth and death
   04210 Apoptosis
    100553927 (akt3)
   04218 Cellular senescence
    100553927 (akt3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100553927 (akt3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100553927 (akt3)
   04625 C-type lectin receptor signaling pathway
    100553927 (akt3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100553927 (akt3)
   04920 Adipocytokine signaling pathway
    100553927 (akt3)
   04914 Progesterone-mediated oocyte maturation
    100553927 (akt3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100553927 (akt3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100553927 (akt3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100553927 (akt3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100553927 (akt3)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100553927 (akt3)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100553927 (akt3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 100553927
NCBI-ProteinID: XP_008115653
Ensembl: ENSACAG00000006720
UniProt: H9GBX3
LinkDB
Position
Un
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFAGINWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttacaattgtgaaagaaggttgggttcaaaaaaggggggaatatataaaa
aattggaggccaagatacttcctattgaagacagatggctctttcatcgggtataaggag
aagcctcaagatgtggatctgccatatcctcttaataatttttcagtagcaaaatgtcag
ctgatgaaaacagagcgaccgaaaccaaacacatttattatccgatgtctacagtggacc
actgtgatagaaaggacatttcacgtagatacaccagaagaacgggaagaatggacagaa
gccatccaggcagtagcagacaggcttcagaggcaggaagaagagagaatgaactgtagt
ccaacctcacagatagataatattggagaggaggagatggatgcttccacaactcaccat
aaaagaaagacaatgaacgattttgattatttgaaactgcttggcaaaggcacctttggc
aaagtaattctggtccgagagaaggcaagtggaaaatactatgctatgaagattttgaaa
aaggaagttattatagcaaaggatgaagtggctcacacacttacagaaagcagagtatta
aaaaatactagacatccctttttaacgtctttgaagtattcattccagaccaaggaccga
ttgtgttttgtgatggaatatgtcaatggaggagagctgtttttccatttgtcgagagag
cgggtgttctctgaggatcgcacacgcttctatggtgcagaaatcgtttctgctttagat
tatctgcattctggaaagattgtgtaccgtgatctcaagttagaaaatctaatgttggat
aaagatggacacataaaaattacagattttggactttgcaaagaaggaatcacagatgca
gctactatgaaaacattctgtggcacaccagagtatttggctcctgaggttttggaagac
aatgactacggtcgtgcagtggattggtggggacttggagttgtcatgtatgaaatgatg
tgtggcaggttgccattctacaaccaagatcatgaaaaactttttgaactaatactaatg
gaggatataaaatttcctcgaacactttcatctgatgcaaaatcactgctttcaggtcta
ctgataaaagatccaaataaacgtcttggtggaggaccagacgacgctaaagaaattatg
cggcacagtttctttgctggaataaactggcaagatgtatatgataaaaagcttgttcct
ccatttaaacctcaagtgacatccgagacagacacgagatattttgatgaagagtttaca
gctcaaactattacaataacaccacctgaaaagtatgatgaagatggcatggactgcatg
gacaatgaaagacgaccacatttcccccagttttcctattctgcaagtggacgagaataa

KEGG   Anolis carolinensis (green anole): 100555477
Entry
100555477         CDS       T01608                                 

Gene name
akt2
Definition
(RefSeq) AKT serine/threonine kinase 2
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04210  Apoptosis
acs04218  Cellular senescence
acs04261  Adrenergic signaling in cardiomyocytes
acs04370  VEGF signaling pathway
acs04371  Apelin signaling pathway
acs04510  Focal adhesion
acs04620  Toll-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04910  Insulin signaling pathway
acs04914  Progesterone-mediated oocyte maturation
acs04920  Adipocytokine signaling pathway
acs05132  Salmonella infection
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100555477 (akt2)
   04012 ErbB signaling pathway
    100555477 (akt2)
   04370 VEGF signaling pathway
    100555477 (akt2)
   04371 Apelin signaling pathway
    100555477 (akt2)
   04068 FoxO signaling pathway
    100555477 (akt2)
   04150 mTOR signaling pathway
    100555477 (akt2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100555477 (akt2)
  09143 Cell growth and death
   04210 Apoptosis
    100555477 (akt2)
   04218 Cellular senescence
    100555477 (akt2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100555477 (akt2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100555477 (akt2)
   04625 C-type lectin receptor signaling pathway
    100555477 (akt2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100555477 (akt2)
   04920 Adipocytokine signaling pathway
    100555477 (akt2)
   04914 Progesterone-mediated oocyte maturation
    100555477 (akt2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100555477 (akt2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100555477 (akt2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100555477 (akt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100555477 (akt2)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100555477 (akt2)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100555477 (akt2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 100555477
NCBI-ProteinID: XP_003222882
Ensembl: ENSACAG00000002886
UniProt: H9G6X3
LinkDB
Position
f
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKEKPETTDQSLPPLNDFSVAEC
QLMKVERPRPNTFIIRCLQWTTVIERTFHVDSPDEREEWIQAIQMVANSLKNQEPEEDRM
DYKCGSPSDSTGAEEMEVAVTKTRAKATMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTNDRLCFVMEYANGGELFFH
LSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKALLAGLLKKDPKQRLGGGPNDAKEVMEHRFFAAINWQDVVQK
KLIPPFKPQVTSEIDTRYFDDEFTAQSITITPPDRYDSLDSLDADQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaatgaagtgtcagtcatcaaggagggctggttgcacaagagaggtgaatacatcaaa
acctggagacccaggtacttcctcctgaagagtgatgggtctttcattggatataaggag
aagcccgaaacaacagatcagagccttccccccttaaatgacttttctgtggcagaatgc
cagttaatgaaagtagagcggccccgtcccaacactttcatcattcgctgtttgcagtgg
acgacagtcattgagaggaccttccatgtggactcgccagatgaaagggaggagtggatc
caggccattcagatggttgctaacagtttaaagaaccaggaacccgaagaagacaggatg
gactacaaatgtggctctcctagtgacagcacaggggccgaggagatggaggtggcagtg
acaaagacccgggccaaggcgaccatgaatgactttgactacctgaagctccttgggaag
ggcacctttgggaaggtcatccttgtgcgggagaaggccactgggcgctactatgccatg
aagatcctgcgcaaagaagtcatcatcgccaaggacgaagtggcccacactgttacagag
agccgagttctgcagaacacaagacatccctttctcacggcactgaaatatgcgttccag
accaatgaccgcctctgctttgtcatggaatacgccaatggtggagagttattcttccac
ctttcaagagagcgtgtcttcaccgaggatcgtgcacgtttctatggggctgagattgtt
tctgccttggaatacctccactctcgggatgttgtttaccgcgacatcaagttggagaac
ctcatgctggataaagacggacacataaaaatcacagactttgggttgtgcaaagagggc
atcacagatggtgccacaatgaagactttctgtgggacgccggagtacctggcccctgag
gtgctggaagacaacgattacgggagagctgtggactggtggggccttggcgttgtcatg
tatgagatgatgtgtgggcgcctgccattctacaaccaagaccacgagcgcctctttgag
ctcattctcatggaggagatacgcttcccacgcacactcagccccgaggccaaggctctg
ctggcaggattgctcaagaaggaccccaagcagaggcttgggggcggccccaatgatgcc
aaggaagttatggagcaccgtttctttgctgccatcaactggcaagatgttgttcaaaag
aagctcatcccccccttcaagccgcaggtgacatctgaaattgacactcgatatttcgat
gacgagttcaccgcgcagtcaataaccatcaccccacctgacagatatgacagtctggat
tccctagatgctgaccagcggacccatttcccccagttttcctactcggccagcatacgg
gagtag

KEGG   Anolis carolinensis (green anole): 100556289
Entry
100556289         CDS       T01608                                 

Gene name
akt1
Definition
(RefSeq) AKT serine/threonine kinase 1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04210  Apoptosis
acs04218  Cellular senescence
acs04261  Adrenergic signaling in cardiomyocytes
acs04370  VEGF signaling pathway
acs04371  Apelin signaling pathway
acs04510  Focal adhesion
acs04620  Toll-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04910  Insulin signaling pathway
acs04914  Progesterone-mediated oocyte maturation
acs04920  Adipocytokine signaling pathway
acs05132  Salmonella infection
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100556289 (akt1)
   04012 ErbB signaling pathway
    100556289 (akt1)
   04370 VEGF signaling pathway
    100556289 (akt1)
   04371 Apelin signaling pathway
    100556289 (akt1)
   04068 FoxO signaling pathway
    100556289 (akt1)
   04150 mTOR signaling pathway
    100556289 (akt1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100556289 (akt1)
  09143 Cell growth and death
   04210 Apoptosis
    100556289 (akt1)
   04218 Cellular senescence
    100556289 (akt1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100556289 (akt1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100556289 (akt1)
   04625 C-type lectin receptor signaling pathway
    100556289 (akt1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100556289 (akt1)
   04920 Adipocytokine signaling pathway
    100556289 (akt1)
   04914 Progesterone-mediated oocyte maturation
    100556289 (akt1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100556289 (akt1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100556289 (akt1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100556289 (akt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100556289 (akt1)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100556289 (akt1)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100556289 (akt1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100556289
NCBI-ProteinID: XP_008101906
Ensembl: ENSACAG00000011455
UniProt: G1KLB6
LinkDB
Position
1
AA seq 480 aa
MNEVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQRESPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQTVADSLKKQEEEIMDF
RSGSPSDNSGAEEMEISMTKPKHKVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNSDHEKLFEL
ILMEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGSDDAKEIMQHKFFSGIVWQDVYEKK
LVPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMDCIDNERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaatgaagtagcaatagtgaaggaaggctggctccacaaacgaggagaatacattaaa
acatggaggccaagatatttcctattgaagaatgatggaacattcattggttacaaggaa
cgaccacaagatgtggaccaacgggagtcccccttaaacaacttctcagtggctcagtgc
cagctgatgaagacagagagacctaaaccaaacacattcatcatcagatgcctccagtgg
accacagtaattgaaaggacgtttcatgtggagactccggaggagcgggaagaatggaca
aaagccatccaaaccgtagcagacagccttaaaaagcaagaggaggaaatcatggatttt
cgatcgggttcccccagtgataattcaggtgccgaagaaatggaaatttctatgacgaaa
ccaaaacacaaagtaactatgaatgaatttgaataccttaagctattggggaaaggtact
tttggaaaagtcatcctggtgaaagaaaaagcaacaggacggtattatgcaatgaagatt
ctgaagaaggaagtaattgttgcaaaggatgaagtggcacataccctgacagaaaaccgg
gttttgcagaactctaggcatcctttcttaacggctttaaagtattccttccagacacat
gaccggttgtgctttgtaatggagtatgctaatggaggcgagctgttcttccatctgtca
cgtgaacgtgtgttttctgaagatcgtgcccggttctacggagctgagattgtatcagcg
ttggactacctacattcagaaaagaatgtggtttatagagacttaaagctggaaaaccta
atgctggacaaagatgggcacataaaaataacagactttgggctgtgcaaagaagggatc
aaggatggagcgacgatgaagactttctgcggcacaccggaatacctcgccccagaggtg
ctggaggacaatgattatggccgcgccgtggactggtggggcttaggcgtcgtcatgtat
gaaatgatgtgcgggcggctccctttctacaattcagaccacgagaagctgtttgaactc
atcctcatggaagagattaggtttccacgcacattgtcgcctgaagcgaaatcccttctg
tcgggcttgctgaaaaaggatcccaagcagaggttagggggcggatcagatgatgccaag
gagatcatgcagcacaaatttttttctggcattgtatggcaagatgtatatgaaaaaaag
ctggtacctccctttaaaccacaggtgacatctgaaacagatacacgctattttgatgaa
gaattcacggcccagatgatcacaattaccccacctgaccaagatgacagtatggattgt
attgacaacgaacgacgaccgcacttccctcagttttcttattccgccagtggaacggct
taa

DBGET integrated database retrieval system