Anolis carolinensis (green anole): 100555877 Help Entry 100555877         CDS       T01608                                  Gene name mapk1 Definition (RefSeq) mitogen-activated protein kinase 1   KO K04371   mitogen-activated protein kinase 1/3 [EC:2.7.11.24] Organism acs  Anolis carolinensis (green anole) Pathway acs04010   MAPK signaling pathway acs04012   ErbB signaling pathway acs04068   FoxO signaling pathway acs04114   Oocyte meiosis acs04140   Autophagy - animal acs04150   mTOR signaling pathway acs04210   Apoptosis acs04218   Cellular senescence acs04261   Adrenergic signaling in cardiomyocytes acs04270   Vascular smooth muscle contraction acs04350   TGF-beta signaling pathway acs04370   VEGF signaling pathway acs04371   Apelin signaling pathway acs04510   Focal adhesion acs04520   Adherens junction acs04540   Gap junction acs04620   Toll-like receptor signaling pathway acs04621   NOD-like receptor signaling pathway acs04625   C-type lectin receptor signaling pathway acs04810   Regulation of actin cytoskeleton acs04910   Insulin signaling pathway acs04912   GnRH signaling pathway acs04914   Progesterone-mediated oocyte maturation acs04916   Melanogenesis acs05132   Salmonella infection Brite KEGG Orthology (KO) [BR:acs00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100555877 (mapk1)    04012 ErbB signaling pathway     100555877 (mapk1)    04350 TGF-beta signaling pathway     100555877 (mapk1)    04370 VEGF signaling pathway     100555877 (mapk1)    04371 Apelin signaling pathway     100555877 (mapk1)    04068 FoxO signaling pathway     100555877 (mapk1)    04150 mTOR signaling pathway     100555877 (mapk1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100555877 (mapk1)   09143 Cell growth and death    04114 Oocyte meiosis     100555877 (mapk1)    04210 Apoptosis     100555877 (mapk1)    04218 Cellular senescence     100555877 (mapk1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100555877 (mapk1)    04520 Adherens junction     100555877 (mapk1)    04540 Gap junction     100555877 (mapk1)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100555877 (mapk1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100555877 (mapk1)    04621 NOD-like receptor signaling pathway     100555877 (mapk1)    04625 C-type lectin receptor signaling pathway     100555877 (mapk1)   09152 Endocrine system    04910 Insulin signaling pathway     100555877 (mapk1)    04912 GnRH signaling pathway     100555877 (mapk1)    04914 Progesterone-mediated oocyte maturation     100555877 (mapk1)    04916 Melanogenesis     100555877 (mapk1)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100555877 (mapk1)    04270 Vascular smooth muscle contraction     100555877 (mapk1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100555877 (mapk1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:acs01001]     100555877 (mapk1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:acs03036]     100555877 (mapk1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acs04147]     100555877 (mapk1) Enzymes [BR:acs01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100555877 (mapk1) Protein kinases [BR:acs01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100555877 (mapk1) Chromosome and associated proteins [BR:acs03036]  Eukaryotic type   Centromeric chromatin formation proteins    SAC (spindle assembly checkpoint) factors     Protein kinases      100555877 (mapk1) Exosome [BR:acs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100555877 (mapk1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kinase-like Kdo Motif Other DBs NCBI-GeneID:  100555877 NCBI-ProteinID:  XP_003225163 Ensembl:  ENSACAG00000001402 UniProt:  H9G541 LinkDB All DBs Position Un AA seq 368 aa AA seqDB search MAAVSGAAGGSGANPAGGPEMVRGQAFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVA IKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRAPTTDQMKDVYIVQDLMETDL YKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKVCDFGLAR VADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKH YLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPYKNKVPWNRLFPNADAKALDLLDK MLTFNPHKRIEVEEALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETA RFQPGYRC NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt atggcggcggtttcgggggcagccgggggcagcggggccaaccccgccgggggccccgag atggtccgcgggcaggccttcgacgtgggaccccgctacaccaacctctcctacatcggc gaaggggcctacggcatggtctgttctgcctatgacaatgtcaacaaagttcgggtggca ataaagaagatcagcccttttgaacaccagacttactgccagaggactctgcgagaaatc aaaatcctcttgcgtttcaagcatgaaaatattattggcatcaatgacattatcagagct ccgacaactgatcaaatgaaagatgtatacattgtgcaagatctcatggagacagacctt tacaagctcttaaagacccagcatctcagcaatgatcacatctgttatttcctttatcaa atcctgagaggattgaaatatatccattcagccaatgtgctgcaccgtgacctcaagcct tccaacttgctgctgaacacaacttgcgatcttaaggtctgtgactttgggttggctcgc gttgcagatcccgatcatgaccacactggcttcctcaccgagtatgtggccacgcgttgg tatcgagctcctgagattatgttgaattcaaagggctataccaaatctattgacatttgg tcagtaggctgtattttggcggaaatgttatccaacagacccatctttccagggaaacac tatctcgatcagctgaaccacattctgggaatacttgggtctccttctcaagaagaccta aactgtataatcaatttgaaagctagaaactatttgctttctctaccgtacaaaaacaaa gtgccgtggaacaggctgtttccaaatgctgacgccaaagctcttgatttgttggataag atgttaaccttcaaccctcataaaagaattgaagttgaagaagctttggcccatccatat ctagagcagtattacgatccaagtgatgagcctgtagcagaagcacctttcaaatttgac atggaactagacgacctgccgaaggaaaagcttaaagaacttatttttgaggaaactgcc agattccagccgggatacagatgctaa

Anolis carolinensis (green anole): 100566699 Help Entry 100566699         CDS       T01608                                  Gene name mapk3 Definition (RefSeq) mitogen-activated protein kinase 3   KO K04371   mitogen-activated protein kinase 1/3 [EC:2.7.11.24] Organism acs  Anolis carolinensis (green anole) Pathway acs04010   MAPK signaling pathway acs04012   ErbB signaling pathway acs04068   FoxO signaling pathway acs04114   Oocyte meiosis acs04140   Autophagy - animal acs04150   mTOR signaling pathway acs04210   Apoptosis acs04218   Cellular senescence acs04261   Adrenergic signaling in cardiomyocytes acs04270   Vascular smooth muscle contraction acs04350   TGF-beta signaling pathway acs04370   VEGF signaling pathway acs04371   Apelin signaling pathway acs04510   Focal adhesion acs04520   Adherens junction acs04540   Gap junction acs04620   Toll-like receptor signaling pathway acs04621   NOD-like receptor signaling pathway acs04625   C-type lectin receptor signaling pathway acs04810   Regulation of actin cytoskeleton acs04910   Insulin signaling pathway acs04912   GnRH signaling pathway acs04914   Progesterone-mediated oocyte maturation acs04916   Melanogenesis acs05132   Salmonella infection Brite KEGG Orthology (KO) [BR:acs00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100566699 (mapk3)    04012 ErbB signaling pathway     100566699 (mapk3)    04350 TGF-beta signaling pathway     100566699 (mapk3)    04370 VEGF signaling pathway     100566699 (mapk3)    04371 Apelin signaling pathway     100566699 (mapk3)    04068 FoxO signaling pathway     100566699 (mapk3)    04150 mTOR signaling pathway     100566699 (mapk3)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100566699 (mapk3)   09143 Cell growth and death    04114 Oocyte meiosis     100566699 (mapk3)    04210 Apoptosis     100566699 (mapk3)    04218 Cellular senescence     100566699 (mapk3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100566699 (mapk3)    04520 Adherens junction     100566699 (mapk3)    04540 Gap junction     100566699 (mapk3)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100566699 (mapk3)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100566699 (mapk3)    04621 NOD-like receptor signaling pathway     100566699 (mapk3)    04625 C-type lectin receptor signaling pathway     100566699 (mapk3)   09152 Endocrine system    04910 Insulin signaling pathway     100566699 (mapk3)    04912 GnRH signaling pathway     100566699 (mapk3)    04914 Progesterone-mediated oocyte maturation     100566699 (mapk3)    04916 Melanogenesis     100566699 (mapk3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100566699 (mapk3)    04270 Vascular smooth muscle contraction     100566699 (mapk3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100566699 (mapk3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:acs01001]     100566699 (mapk3)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:acs03036]     100566699 (mapk3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acs04147]     100566699 (mapk3) Enzymes [BR:acs01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100566699 (mapk3) Protein kinases [BR:acs01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100566699 (mapk3) Chromosome and associated proteins [BR:acs03036]  Eukaryotic type   Centromeric chromatin formation proteins    SAC (spindle assembly checkpoint) factors     Protein kinases      100566699 (mapk3) Exosome [BR:acs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100566699 (mapk3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase NDUF_B4 Kdo Motif Other DBs NCBI-GeneID:  100566699 NCBI-ProteinID:  XP_016851543 Ensembl:  ENSACAG00000015056 UniProt:  H9GLX1 LinkDB All DBs Position Un AA seq 375 aa AA seqDB search MSAATAAAPGGAGAVPVPGAPRLGVETVKGQVFDVGPRYTDLQYIGEGAYGMVCSSYDHV NKIRAAIKKISPFEHQTYCQRTLREIKILLRFKHENVIGINDILRAPTIDQMRDVYIVQD LMETDLYKLLKTQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKIC DFGLARIADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRP IFPGKHYLDQLNHILGILGSPSQDDLNCIINMKARNYLQSLPQKPKVPWNKLFPKADPKA LDLLDKMLTFNPNKRITVEESLAHPYLEQYYDPSDEPVAEEPFTFDMELDDLPKEKLKEL IFEETARFQPGYQGP NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atgtcggcagcgacagcagcagcgcctggtggggcaggagccgtgccggtgcccggggcg ccgaggctgggcgtggagacggtgaaagggcaggtcttcgacgtgggcccgcgctacacg gacctgcagtacatcggcgagggcgcctacggaatggtgtgttcttcttatgaccacgtg aacaagattcgagctgccatcaaaaagatcagtcccttcgagcatcaaacttattgccaa cgcacactgcgcgaaataaaaatactactccgctttaaacatgagaacgtcatcggcatc aatgacattctgcgtgcccctactattgatcagatgcgtgatgtatacatagttcaggat ttaatggagacagatctgtacaagttgctaaagacccagcaactcagcaacgaccacatc tgttacttcctctaccagattctccgagggctgaaatacattcattctgccaatgtgctg catcgggatctaaagcccagcaatcttctcatcaataccacatgtgacctgaagatctgt gattttggcttggcccgaattgctgatccagaccatgaccacacagggttcttgacagaa tatgttgccacccgctggtaccgagcccctgaaatcatgctcaattccaagggctacacc aagtccattgatatatggtctgtgggctgcatcctggcagagatgctgtcgaaccgaccc atctttcctggcaagcactacctggaccagctcaaccatatcctgggtattctaggttcc ccatctcaggatgacctgaactgcatcatcaatatgaaggctcgcaactatctccagtcg ctgccccaaaagcccaaggttccgtggaacaaactgtttcctaaggcagatcccaaagct ctagacctgttggacaaaatgttgacctttaaccccaacaaacgcatcacagtggaggag tccttggcccatccttacctagagcagtactacgacccctcagatgagcccgttgctgaa gagccattcacttttgacatggagctggatgaccttcccaaagagaagctgaaagaactg atatttgaggagacagcacgcttccagcctggctatcaaggtccctga

DBGET integrated database retrieval system