KEGG   Anolis carolinensis (green anole): 100555877
Entry
100555877         CDS       T01608                                 

Gene name
mapk1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04114  Oocyte meiosis
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04210  Apoptosis
acs04218  Cellular senescence
acs04261  Adrenergic signaling in cardiomyocytes
acs04270  Vascular smooth muscle contraction
acs04350  TGF-beta signaling pathway
acs04370  VEGF signaling pathway
acs04371  Apelin signaling pathway
acs04510  Focal adhesion
acs04520  Adherens junction
acs04540  Gap junction
acs04620  Toll-like receptor signaling pathway
acs04621  NOD-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04810  Regulation of actin cytoskeleton
acs04910  Insulin signaling pathway
acs04912  GnRH signaling pathway
acs04914  Progesterone-mediated oocyte maturation
acs04916  Melanogenesis
acs05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100555877 (mapk1)
   04012 ErbB signaling pathway
    100555877 (mapk1)
   04350 TGF-beta signaling pathway
    100555877 (mapk1)
   04370 VEGF signaling pathway
    100555877 (mapk1)
   04371 Apelin signaling pathway
    100555877 (mapk1)
   04068 FoxO signaling pathway
    100555877 (mapk1)
   04150 mTOR signaling pathway
    100555877 (mapk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100555877 (mapk1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100555877 (mapk1)
   04210 Apoptosis
    100555877 (mapk1)
   04218 Cellular senescence
    100555877 (mapk1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100555877 (mapk1)
   04520 Adherens junction
    100555877 (mapk1)
   04540 Gap junction
    100555877 (mapk1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100555877 (mapk1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100555877 (mapk1)
   04621 NOD-like receptor signaling pathway
    100555877 (mapk1)
   04625 C-type lectin receptor signaling pathway
    100555877 (mapk1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100555877 (mapk1)
   04912 GnRH signaling pathway
    100555877 (mapk1)
   04914 Progesterone-mediated oocyte maturation
    100555877 (mapk1)
   04916 Melanogenesis
    100555877 (mapk1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100555877 (mapk1)
   04270 Vascular smooth muscle contraction
    100555877 (mapk1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100555877 (mapk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100555877 (mapk1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:acs03036]
    100555877 (mapk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acs04147]
    100555877 (mapk1)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100555877 (mapk1)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100555877 (mapk1)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100555877 (mapk1)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100555877 (mapk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kinase-like Kdo
Other DBs
NCBI-GeneID: 100555877
NCBI-ProteinID: XP_003225163
Ensembl: ENSACAG00000001402
UniProt: H9G541
LinkDB
Position
Un
AA seq 368 aa
MAAVSGAAGGSGANPAGGPEMVRGQAFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVA
IKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRAPTTDQMKDVYIVQDLMETDL
YKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKVCDFGLAR
VADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKH
YLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPYKNKVPWNRLFPNADAKALDLLDK
MLTFNPHKRIEVEEALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETA
RFQPGYRC
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggcggcggtttcgggggcagccgggggcagcggggccaaccccgccgggggccccgag
atggtccgcgggcaggccttcgacgtgggaccccgctacaccaacctctcctacatcggc
gaaggggcctacggcatggtctgttctgcctatgacaatgtcaacaaagttcgggtggca
ataaagaagatcagcccttttgaacaccagacttactgccagaggactctgcgagaaatc
aaaatcctcttgcgtttcaagcatgaaaatattattggcatcaatgacattatcagagct
ccgacaactgatcaaatgaaagatgtatacattgtgcaagatctcatggagacagacctt
tacaagctcttaaagacccagcatctcagcaatgatcacatctgttatttcctttatcaa
atcctgagaggattgaaatatatccattcagccaatgtgctgcaccgtgacctcaagcct
tccaacttgctgctgaacacaacttgcgatcttaaggtctgtgactttgggttggctcgc
gttgcagatcccgatcatgaccacactggcttcctcaccgagtatgtggccacgcgttgg
tatcgagctcctgagattatgttgaattcaaagggctataccaaatctattgacatttgg
tcagtaggctgtattttggcggaaatgttatccaacagacccatctttccagggaaacac
tatctcgatcagctgaaccacattctgggaatacttgggtctccttctcaagaagaccta
aactgtataatcaatttgaaagctagaaactatttgctttctctaccgtacaaaaacaaa
gtgccgtggaacaggctgtttccaaatgctgacgccaaagctcttgatttgttggataag
atgttaaccttcaaccctcataaaagaattgaagttgaagaagctttggcccatccatat
ctagagcagtattacgatccaagtgatgagcctgtagcagaagcacctttcaaatttgac
atggaactagacgacctgccgaaggaaaagcttaaagaacttatttttgaggaaactgcc
agattccagccgggatacagatgctaa

KEGG   Anolis carolinensis (green anole): 100566699
Entry
100566699         CDS       T01608                                 

Gene name
mapk3
Definition
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04114  Oocyte meiosis
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04210  Apoptosis
acs04218  Cellular senescence
acs04261  Adrenergic signaling in cardiomyocytes
acs04270  Vascular smooth muscle contraction
acs04350  TGF-beta signaling pathway
acs04370  VEGF signaling pathway
acs04371  Apelin signaling pathway
acs04510  Focal adhesion
acs04520  Adherens junction
acs04540  Gap junction
acs04620  Toll-like receptor signaling pathway
acs04621  NOD-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04810  Regulation of actin cytoskeleton
acs04910  Insulin signaling pathway
acs04912  GnRH signaling pathway
acs04914  Progesterone-mediated oocyte maturation
acs04916  Melanogenesis
acs05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100566699 (mapk3)
   04012 ErbB signaling pathway
    100566699 (mapk3)
   04350 TGF-beta signaling pathway
    100566699 (mapk3)
   04370 VEGF signaling pathway
    100566699 (mapk3)
   04371 Apelin signaling pathway
    100566699 (mapk3)
   04068 FoxO signaling pathway
    100566699 (mapk3)
   04150 mTOR signaling pathway
    100566699 (mapk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100566699 (mapk3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100566699 (mapk3)
   04210 Apoptosis
    100566699 (mapk3)
   04218 Cellular senescence
    100566699 (mapk3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100566699 (mapk3)
   04520 Adherens junction
    100566699 (mapk3)
   04540 Gap junction
    100566699 (mapk3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100566699 (mapk3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100566699 (mapk3)
   04621 NOD-like receptor signaling pathway
    100566699 (mapk3)
   04625 C-type lectin receptor signaling pathway
    100566699 (mapk3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100566699 (mapk3)
   04912 GnRH signaling pathway
    100566699 (mapk3)
   04914 Progesterone-mediated oocyte maturation
    100566699 (mapk3)
   04916 Melanogenesis
    100566699 (mapk3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100566699 (mapk3)
   04270 Vascular smooth muscle contraction
    100566699 (mapk3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100566699 (mapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100566699 (mapk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:acs03036]
    100566699 (mapk3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acs04147]
    100566699 (mapk3)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100566699 (mapk3)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100566699 (mapk3)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100566699 (mapk3)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100566699 (mapk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase NDUF_B4 Kdo
Other DBs
NCBI-GeneID: 100566699
NCBI-ProteinID: XP_016851543
Ensembl: ENSACAG00000015056
UniProt: H9GLX1
LinkDB
Position
Un
AA seq 375 aa
MSAATAAAPGGAGAVPVPGAPRLGVETVKGQVFDVGPRYTDLQYIGEGAYGMVCSSYDHV
NKIRAAIKKISPFEHQTYCQRTLREIKILLRFKHENVIGINDILRAPTIDQMRDVYIVQD
LMETDLYKLLKTQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKIC
DFGLARIADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRP
IFPGKHYLDQLNHILGILGSPSQDDLNCIINMKARNYLQSLPQKPKVPWNKLFPKADPKA
LDLLDKMLTFNPNKRITVEESLAHPYLEQYYDPSDEPVAEEPFTFDMELDDLPKEKLKEL
IFEETARFQPGYQGP
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgtcggcagcgacagcagcagcgcctggtggggcaggagccgtgccggtgcccggggcg
ccgaggctgggcgtggagacggtgaaagggcaggtcttcgacgtgggcccgcgctacacg
gacctgcagtacatcggcgagggcgcctacggaatggtgtgttcttcttatgaccacgtg
aacaagattcgagctgccatcaaaaagatcagtcccttcgagcatcaaacttattgccaa
cgcacactgcgcgaaataaaaatactactccgctttaaacatgagaacgtcatcggcatc
aatgacattctgcgtgcccctactattgatcagatgcgtgatgtatacatagttcaggat
ttaatggagacagatctgtacaagttgctaaagacccagcaactcagcaacgaccacatc
tgttacttcctctaccagattctccgagggctgaaatacattcattctgccaatgtgctg
catcgggatctaaagcccagcaatcttctcatcaataccacatgtgacctgaagatctgt
gattttggcttggcccgaattgctgatccagaccatgaccacacagggttcttgacagaa
tatgttgccacccgctggtaccgagcccctgaaatcatgctcaattccaagggctacacc
aagtccattgatatatggtctgtgggctgcatcctggcagagatgctgtcgaaccgaccc
atctttcctggcaagcactacctggaccagctcaaccatatcctgggtattctaggttcc
ccatctcaggatgacctgaactgcatcatcaatatgaaggctcgcaactatctccagtcg
ctgccccaaaagcccaaggttccgtggaacaaactgtttcctaaggcagatcccaaagct
ctagacctgttggacaaaatgttgacctttaaccccaacaaacgcatcacagtggaggag
tccttggcccatccttacctagagcagtactacgacccctcagatgagcccgttgctgaa
gagccattcacttttgacatggagctggatgaccttcccaaagagaagctgaaagaactg
atatttgaggagacagcacgcttccagcctggctatcaaggtccctga

DBGET integrated database retrieval system