KEGG   Anolis carolinensis (green anole): 100555967
Entry
100555967         CDS       T01608                                 

Gene name
cd82
Definition
(RefSeq) CD82 molecule
  KO
K06509  CD82 antigen
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100555967 (cd82)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acs04147]
    100555967 (cd82)
   04090 CD molecules [BR:acs04090]
    100555967 (cd82)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100555967 (cd82)
  Exosomal proteins of other body fluids (saliva and urine)
   100555967 (cd82)
  Exosomal proteins of colorectal cancer cells
   100555967 (cd82)
CD molecules [BR:acs04090]
 Proteins
  100555967 (cd82)
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-GeneID: 100555967
NCBI-ProteinID: XP_003214674
Ensembl: ENSACAG00000014373
UniProt: G1KPW0
LinkDB
Position
1
AA seq 264 aa
MGSGCLKVTKYFLFLFNLLFFILGAVILGFGIWILVDKSSFISVLQTSSYSLKVGAYILI
GVGSVTMLMGFLGCVGAVNEIRCLLGLYFTCLLLILIAQVAAGLLIYFQRSALKAEMAGI
VGDLIQNYNPYDESNRNLETAWDYVQTQLSCCGWAGPENWKNNTILQEKNETSYPCSCSN
DSVDPAAEVGFCPLENTPNTTTFESWPVKKQGCMKGVQNWLKENLGIILGVCTGVAVIEL
LGMVLSICLCKNIHTEEYTKVPKY
NT seq 795 nt   +upstreamnt  +downstreamnt
atggggtccggctgtctgaaggtcacaaagtacttccttttcctcttcaacctccttttt
tttatcttgggtgctgtgatccttggctttggaatatggattttggttgacaagagtagc
ttcatttcagttctacagacctcctcatactcattaaaggttggggcatatattctcatc
ggagttgggtctgtcacaatgttgatgggtttccttggttgtgttggagcagtcaatgag
attcgatgtctcttggggctgtactttacctgcctgctgttgatcctaatagcccaggta
gcagccggtctgctcatctacttccagcggagtgcactcaaagcagaaatggcagggatt
gttggtgaccttatccagaattacaacccttatgatgaaagcaataggaaccttgagact
gcatgggattatgtccagacacagctgtcttgttgcggatgggctggaccagaaaattgg
aaaaacaatacaattctgcaggaaaaaaatgagacatcctacccttgctcttgtagcaat
gactcagttgacccagcggcagaggtgggcttctgccctttggaaaatactcccaacacc
accacatttgagagctggccagttaaaaagcaggggtgtatgaaaggtgtgcagaactgg
ttaaaggagaacctcggcatcattcttggagtctgcacaggtgttgctgtcattgagctc
ctgggaatggtgctctcgatctgcctctgcaagaatatacacaccgaagagtacaccaaa
gtgcccaagtactga

KEGG   Anolis carolinensis (green anole): 100559286
Entry
100559286         CDS       T01608                                 

Gene name
cd37
Definition
(RefSeq) CD37 molecule
  KO
K06509  CD82 antigen
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100559286 (cd37)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acs04147]
    100559286 (cd37)
   04090 CD molecules [BR:acs04090]
    100559286 (cd37)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100559286 (cd37)
  Exosomal proteins of other body fluids (saliva and urine)
   100559286 (cd37)
  Exosomal proteins of colorectal cancer cells
   100559286 (cd37)
CD molecules [BR:acs04090]
 Proteins
  100559286 (cd37)
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-GeneID: 100559286
NCBI-ProteinID: XP_008117099
Ensembl: ENSACAG00000017465
LinkDB
Position
Un
AA seq 244 aa
MSHKGCLSVIKYFLFIFNLFFFMLGSLLFSFGLWILFDRNNFASVLGSSYYALKVWSYIF
CGVGILTMLMGFLGCLGSLKEIKCMLGFYFAFLLLLFIAQITIGILIYVQQNSLKKTVGE
YVNGIIETYGAKSSYSDHEESWDFVQKQFQCCGWTSYSDWRKNPRVHNSSDLFPCSCYNA
SQSSPLEINQTANVEPEGFCKTLGEWPVYKEGCMRSVEVWVTNNIITVVGICLGIALLEV
RDLD
NT seq 735 nt   +upstreamnt  +downstreamnt
atgtcccacaaaggatgccttagcgtcataaagtacttcctcttcatcttcaacctcttc
ttttttatgcttggaagtcttctcttcagctttggcttatggatcctttttgaccgaaac
aattttgcttctgttcttgggtcatcatattatgccctaaaagtctggtcctatatcttc
tgtggtgttggcatcctcacaatgttgatgggtttccttggatgtctaggttccctcaag
gagatcaagtgcatgctgggattttactttgccttcctgctcctcctttttattgctcag
atcaccatcgggatcctgatatatgtacagcaaaactcgctcaagaaaactgttggagaa
tatgtaaatggcataatcgaaacttatggagcaaaaagttcctactctgatcatgaagag
agctgggattttgtgcaaaagcagttccagtgttgtggatggacctcttatagcgactgg
aggaagaacccgagagtccacaactcctccgacctcttcccctgttcctgttacaatgct
tctcagtctagtcctctggagattaatcagacggcaaacgtggagcctgaaggcttctgc
aaaactttgggcgagtggccagtctacaaggagggctgcatgcgtagtgttgaagtctgg
gtgaccaataatatcatcacagttgtggggatctgccttggcattgcccttctcgaggta
agagatcttgactag

DBGET integrated database retrieval system