KEGG   Anolis carolinensis (green anole): 100556906
Entry
100556906         CDS       T01608                                 

Gene name
gtse1
Definition
(RefSeq) G2 and S-phase expressed 1
  KO
K10129  G-2 and S-phase expressed protein 1
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100556906 (gtse1)
SSDB
Motif
Pfam: GTSE1_N
Other DBs
NCBI-GeneID: 100556906
NCBI-ProteinID: XP_016849676
LinkDB
Position
5
AA seq 632 aa
SDDEVFVGPMGHKEKCIAVLLESQEGPKNKCSPSAQDAPTWSPLAGEKFVEIFKEAHLVA
LQLQSASKTKRKNAGQQEEAKSATVEKFVQESKSKLKILERGIVTNKTPTSIKRETFYVA
ESPVSQLPPSLQKCSSHPARMTEDSPLPQRLLNYSSPRQLDKLPKASVMHLSQSKSDKSI
KKPSTFQPVKNASVNNNSVTTGQPKQEKLSSSSSRNDLNGMGSSEDLLSEKLSIASDGDP
PFCNSSSAPSKLSAKTRQLKAPSNVRMRKITSSSSSSSVSSMNSSLNSSLSLSPKPGKGP
MKMSLGQTSHVDTSGNLQKSTSATKGNLSVSVPKYRAAATAAKCETSGSGIQKGGSNPTQ
KLAQKSMLGNLRASSSPKLKTKAMSPVSKEDASAKNVAARVLQPVKLLPCGNAESNVAVT
PPLKQSEEGSMLKFCSAAKSALRTPASNVKHSSLPTPVGRRISGIPMLTPKTLPRSMSSP
NPEPLHQVSNVTSKKPQVPSTKWEKDSKTKVSTSSSSSAEEDSTLSQIVPIALVFSPEKS
SEEMEQDATKKEEAAKESLLVDIGLDKTPIGVDKIVIQKCENKPLIDLFNTPEVIKASPI
KPTGQLIDLSSPLIQLGPEGNKENIDSPLLKF
NT seq 1899 nt   +upstreamnt  +downstreamnt
agtgacgatgaagtttttgttggaccaatgggacataaagaaaaatgtattgctgtcttg
cttgaatctcaagaaggaccaaagaataaatgctcaccatcagctcaggatgcaccaaca
tggagtcctcttgctggagagaaatttgttgaaatttttaaggaagcccatctggtagca
ctgcaactacaaagtgcaagcaaaaccaaacgaaaaaatgctggccagcaggaagaagca
aagtcagcgactgttgaaaagtttgtgcaagaatcaaaatcaaaactgaagatccttgag
agaggaatagtgaccaataaaaccccaacatcgattaagagagagacgttttatgtggcg
gaaagcccagtttcccaactgccaccttcattacagaagtgttcaagtcatcctgccaga
atgacggaggactctcctctcccgcaaagacttctaaattattctagtcccaggcaactg
gataaattacccaaagcatctgtgatgcatttatcccaatcaaagagtgacaaaagcatt
aaaaaaccaagcacatttcagcctgttaaaaatgcatctgtaaataacaatagcgtaaca
acaggacagccaaaacaagagaagctttcaagttcttccagcaggaatgatctgaatggc
atggggtcatctgaagatttgctctctgaaaaattaagcattgcttcagatggagaccca
ccattttgtaacagttcttctgctcctagcaagttgagtgcgaagacaaggcaactgaaa
gctccaagtaatgtccgtatgagaaaaattacatcatcatcttcatcgtcatctgtttcc
agcatgaattcaagcctgaattcaagcctgtcactgtcacctaaacctggaaaaggccct
atgaaaatgtcattggggcagacttctcatgtggatacatctggaaatctacaaaaatct
acaagtgctactaaaggaaacctttctgtcagtgtacccaaatatagagcagctgctact
gctgctaaatgtgagacctcaggcagtgggattcagaaagggggttcaaatcctactcag
aaactggcacagaaaagtatgctgggaaacctaagagcaagttcgagccctaaactcaaa
actaaagcaatgtctccagtctcaaaagaagatgcgtctgcaaaaaatgtagctgccaga
gtactgcaaccagtcaagttattaccctgtggcaatgctgaaagcaatgttgcagtcacg
ccacctctcaaacagtcagaagaagggagtatgttaaaattctgttctgctgcaaaatct
gctttacggactcctgccagtaatgtcaagcattcttcgttgcctacacctgttggtcga
cgcatttctggaattccaatgctgacccccaaaactctgcctagatcgatgtcttctcct
aatcctgaacctcttcatcaggtctccaatgtgacttccaaaaaaccacaagtgccaagc
acaaaatgggaaaaggacagcaagacaaaggtgagcacctctagctcatcttcagcagag
gaagactcaactctatcacagattgtacctattgcgcttgtcttttcgccagagaaatct
tctgaagaaatggaacaggatgcgactaaaaaagaggaagcagctaaagagagtctgctg
gtagacattggacttgataaaacaccaatcggagtagataaaattgtcatccagaagtgt
gaaaacaaacctctcattgatctttttaacactcctgaagtaattaaggcttctcctatt
aaacctacaggacagctaatagatctgagctctcctctgattcaacttggccctgaagga
aataaagaaaacatagattctcctcttctgaagttttga

DBGET integrated database retrieval system